Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
56033
Gene name Gene Name - the full gene name approved by the HGNC.
BARX homeobox 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BARX1
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9q22.32
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the Bar subclass of homeobox transcription factors. Studies of the mouse and chick homolog suggest the encoded protein may play a role in developing teeth and craniofacial mesenchyme of neural crest origin. The protein may al
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022812 hsa-miR-124-3p Microarray 18668037
MIRT500192 hsa-miR-4781-5p PAR-CLIP 20371350
MIRT500191 hsa-miR-151a-5p PAR-CLIP 20371350
MIRT500190 hsa-miR-151b PAR-CLIP 20371350
MIRT500189 hsa-miR-744-5p PAR-CLIP 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603260 955 ENSG00000131668
Protein
UniProt ID Q9HBU1
Protein name Homeobox protein BarH-like 1
Protein function Transcription factor, which is involved in craniofacial development, in odontogenesis and in stomach organogenesis. May have a role in the differentiation of molars from incisors. Plays a role in suppressing endodermal Wnt activity (By similarit
PDB 2DMT
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 143 199 Homeodomain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed at higher levels in testis and heart. Detected in craniofacial tissue and adult iris, but not in lymphocytes, fibroblasts, choroid retina, retinal pigment epithelium, kidney, or fetal liver.
Sequence
MQRPGEPGAARFGPPEGCADHRPHRYRSFMIEEILTEPPGPKGAAPAAAAAAAGELLKFG
VQALLAARPFHSHLAVLKAEQAAVFKFPLAPLGCSGLSSALLAAGPGLPGAAGAPHLPLE
LQLRGKLEAAGPGEPGTKAKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLG
LSQLQVKTWYQNRRMKWKK
IVLQGGGLESPTKPKGRPKKNSIPTSEQLTEQERAKDAEKP
AEVPGEPSDRSRED
Sequence length 254
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Barrett esophagus Barrett's esophagus N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 24121790, 25447851, 26383589, 34505128
Adenocarcinoma of Lung Associate 36353226
Barrett Esophagus Associate 25447851
Cleft Lip Associate 18708738
Gastrointestinal Stromal Tumors Associate 33451979
Inflammation Associate 35133179
Neoplasms Associate 36927457
Neoplasms Stimulate 37284741
Odontogenic Cysts Associate 36344906
Odontogenic Tumors Associate 36344906