Gene Gene information from NCBI Gene database.
Entrez ID 56033
Gene name BARX homeobox 1
Gene symbol BARX1
Synonyms (NCBI Gene)
-
Chromosome 9
Chromosome location 9q22.32
Summary This gene encodes a member of the Bar subclass of homeobox transcription factors. Studies of the mouse and chick homolog suggest the encoded protein may play a role in developing teeth and craniofacial mesenchyme of neural crest origin. The protein may al
miRNA miRNA information provided by mirtarbase database.
45
miRTarBase ID miRNA Experiments Reference
MIRT022812 hsa-miR-124-3p Microarray 18668037
MIRT500192 hsa-miR-4781-5p PAR-CLIP 20371350
MIRT500191 hsa-miR-151a-5p PAR-CLIP 20371350
MIRT500190 hsa-miR-151b PAR-CLIP 20371350
MIRT500189 hsa-miR-744-5p PAR-CLIP 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603260 955 ENSG00000131668
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9HBU1
Protein name Homeobox protein BarH-like 1
Protein function Transcription factor, which is involved in craniofacial development, in odontogenesis and in stomach organogenesis. May have a role in the differentiation of molars from incisors. Plays a role in suppressing endodermal Wnt activity (By similarit
PDB 2DMT
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 143 199 Homeodomain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed at higher levels in testis and heart. Detected in craniofacial tissue and adult iris, but not in lymphocytes, fibroblasts, choroid retina, retinal pigment epithelium, kidney, or fetal liver.
Sequence
MQRPGEPGAARFGPPEGCADHRPHRYRSFMIEEILTEPPGPKGAAPAAAAAAAGELLKFG
VQALLAARPFHSHLAVLKAEQAAVFKFPLAPLGCSGLSSALLAAGPGLPGAAGAPHLPLE
LQLRGKLEAAGPGEPGTKAKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLG
LSQLQVKTWYQNRRMKWKK
IVLQGGGLESPTKPKGRPKKNSIPTSEQLTEQERAKDAEKP
AEVPGEPSDRSRED
Sequence length 254
Interactions View interactions