Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5600
Gene name Gene Name - the full gene name approved by the HGNC.	Mitogen-activated protein kinase 11
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MAPK11
Synonyms (NCBI Gene) Gene synonyms aliases	P38B, P38BETA2, PRKM11, SAPK2, SAPK2B, p38-2, p38Beta
Chromosome Chromosome number	22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	22q13.33
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of a family of protein kinases that are involved in the integration of biochemical signals for a wide variety of cellular processes, including cell proliferation, differentiation, transcriptional regulation, and development. The

Show/Hide all(28)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003097	hsa-miR-122-5p	Luciferase reporter assay, qRT-PCR	19296470
MIRT022536	hsa-miR-124-3p	Microarray	18668037
MIRT052537	hsa-let-7a-5p	CLASH	23622248
MIRT1130063	hsa-miR-1205	CLIP-seq
MIRT1130064	hsa-miR-1302	CLIP-seq
MIRT1130065	hsa-miR-1909	CLIP-seq
MIRT1130066	hsa-miR-298	CLIP-seq
MIRT1130067	hsa-miR-3663-3p	CLIP-seq
MIRT1130068	hsa-miR-3918	CLIP-seq
MIRT1130069	hsa-miR-4298	CLIP-seq
MIRT1130070	hsa-miR-4330	CLIP-seq
MIRT1130071	hsa-miR-4436b-3p	CLIP-seq
MIRT1130072	hsa-miR-4640-5p	CLIP-seq
MIRT1130073	hsa-miR-4726-5p	CLIP-seq
MIRT1130074	hsa-miR-541	CLIP-seq
MIRT1130075	hsa-miR-574-3p	CLIP-seq
MIRT1130076	hsa-miR-602	CLIP-seq
MIRT1130077	hsa-miR-654-5p	CLIP-seq
MIRT2037035	hsa-miR-204	CLIP-seq
MIRT2037036	hsa-miR-211	CLIP-seq
MIRT2037037	hsa-miR-4643	CLIP-seq
MIRT2037038	hsa-miR-627	CLIP-seq
MIRT2267113	hsa-miR-1915	CLIP-seq
MIRT2453706	hsa-miR-296-5p	CLIP-seq
MIRT2453707	hsa-miR-4292	CLIP-seq
MIRT2453708	hsa-miR-4308	CLIP-seq
MIRT2453709	hsa-miR-4749-3p	CLIP-seq
MIRT2453710	hsa-miR-670	CLIP-seq

Show/Hide all(25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000187	Process	Activation of MAPK activity	TAS
GO:0004674	Function	Protein serine/threonine kinase activity	IBA	21873635
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0004707	Function	MAP kinase activity	IBA	21873635
GO:0004707	Function	MAP kinase activity	IDA	8663524, 10330143
GO:0005515	Function	Protein binding	IPI	17254968, 17380123, 21988832, 23602568, 28514442, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0006468	Process	Protein phosphorylation	IEA
GO:0007265	Process	Ras protein signal transduction	TAS
GO:0010628	Process	Positive regulation of gene expression	IMP	25754930
GO:0032735	Process	Positive regulation of interleukin-12 production	IMP	25754930
GO:0035556	Process	Intracellular signal transduction	IBA	21873635
GO:0045648	Process	Positive regulation of erythrocyte differentiation	IMP	23483889
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	TAS
GO:0051090	Process	Regulation of DNA-binding transcription factor activity	TAS
GO:0051149	Process	Positive regulation of muscle cell differentiation	TAS
GO:0051403	Process	Stress-activated MAPK cascade	IDA	8663524
GO:0060044	Process	Negative regulation of cardiac muscle cell proliferation	IEA
GO:0071347	Process	Cellular response to interleukin-1	IDA	8663524
GO:0098586	Process	Cellular response to virus	IMP	25754930
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	TAS

MIM	HGNC	e!Ensembl
602898	6873	ENSG00000185386

Protein

UniProt ID

Q15759

Protein name

Mitogen-activated protein kinase 11 (MAP kinase 11) (MAPK 11) (EC 2.7.11.24) (Mitogen-activated protein kinase p38 beta) (MAP kinase p38 beta) (p38b) (Stress-activated protein kinase 2b) (SAPK2b) (p38-2)

Protein function

Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway (PubMed:12452429, PubMed:20626350, PubMed:35857590). MAPK11 is one of the four p38 MAPKs which play an important role in the cascades of c

PDB

3GC8 , 3GC9 , 3GP0 , 8YGW

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	24 → 308	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highest levels in the brain and heart. Also expressed in the placenta, lung, liver, skeletal muscle, kidney and pancreas.

Sequence

MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ
SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ
ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVG
TPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAA
EALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSL
EIEQ

Sequence length

364

Interactions

View interactions

	KEGG		Reactome
	Endocrine resistance MAPK signaling pathway Rap1 signaling pathway FoxO signaling pathway Sphingolipid signaling pathway Oocyte meiosis Efferocytosis Cellular senescence Adrenergic signaling in cardiomyocytes VEGF signaling pathway Osteoclast differentiation Signaling pathways regulating pluripotency of stem cells Platelet activation Neutrophil extracellular trap formation Toll-like receptor signaling pathway NOD-like receptor signaling pathway RIG-I-like receptor signaling pathway C-type lectin receptor signaling pathway IL-17 signaling pathway Th1 and Th2 cell differentiation Th17 cell differentiation T cell receptor signaling pathway Fc epsilon RI signaling pathway TNF signaling pathway Leukocyte transendothelial migration Thermogenesis Neurotrophin signaling pathway Retrograde endocannabinoid signaling Dopaminergic synapse Inflammatory mediator regulation of TRP channels GnRH signaling pathway Progesterone-mediated oocyte maturation Prolactin signaling pathway Relaxin signaling pathway Non-alcoholic fatty liver disease AGE-RAGE signaling pathway in diabetic complications Growth hormone synthesis, secretion and action Alcoholic liver disease Amyotrophic lateral sclerosis Prion disease Pathways of neurodegeneration - multiple diseases Epithelial cell signaling in Helicobacter pylori infection Pathogenic Escherichia coli infection Shigellosis Salmonella infection Pertussis Yersinia infection Leishmaniasis Chagas disease Toxoplasmosis Tuberculosis Hepatitis B Human cytomegalovirus infection Kaposi sarcoma-associated herpesvirus infection Epstein-Barr virus infection Human immunodeficiency virus 1 infection Coronavirus disease - COVID-19 Proteoglycans in cancer Chemical carcinogenesis - reactive oxygen species PD-L1 expression and PD-1 checkpoint pathway in cancer Diabetic cardiomyopathy Lipid and atherosclerosis Fluid shear stress and atherosclerosis		NOD1/2 Signaling Pathway p38MAPK events ERK/MAPK targets Oxidative Stress Induced Senescence DSCAM interactions VEGFA-VEGFR2 Pathway activated TAK1 mediates p38 MAPK activation Activation of the AP-1 family of transcription factors Myogenesis RHO GTPases Activate NADPH Oxidases Regulation of TP53 Activity through Phosphorylation

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Cardiomyopathy	Cardiomyopathies, Primary, Cardiomyopathies	rs267607003, rs267607002, rs267607004, rs63750743, rs121908333, rs121908334, rs104894655, rs121434420, rs121434421, rs193922674, rs111517471, rs121908987, rs193922384, rs121909374, rs121909377 View all (900 more)	10620750

Show/Hide Text Mining Associations (22)

Disease Name	Relationship Type	References
Associations from Text Mining
Breast Neoplasms	Associate	36744961
Carcinoma Renal Cell	Associate	37525479
Colonic Neoplasms	Associate	11448946
COVID 19	Associate	37345956
Endometrial Neoplasms	Associate	31123170
Fibrosis	Associate	37169841
Hodgkin Disease	Associate	11162833
Infections	Associate	16988231
Inflammation	Associate	14694199
Intervertebral Disc Degeneration	Associate	26911458
Kidney Diseases	Associate	35618095
Leukemia Lymphoma Adult T Cell	Associate	37832654
Leukemia Promyelocytic Acute	Inhibit	15273249
Lung Neoplasms	Associate	22415779
Neoplasms	Associate	11294892, 11448946, 31242243, 37525479
Prostatic Neoplasms	Associate	37394064
Prostatic Neoplasms Castration Resistant	Associate	37394064
Renal Insufficiency	Associate	35618095
Reoviridae Infections	Associate	36744961
Sezary Syndrome	Associate	25148579
Squamous Cell Carcinoma of Head and Neck	Associate	29747487
Triple Negative Breast Neoplasms	Associate	37569854

MAPK11 (mitogen-activated protein kinase 11)