Gene Gene information from NCBI Gene database.
Entrez ID 55920
Gene name Regulator of chromosome condensation 2
Gene symbol RCC2
Synonyms (NCBI Gene)
TD-60
Chromosome 1
Chromosome location 1p36.13
Summary The protein encoded by this gene is a guanine exchange factor that is active on RalA, a small GTPase. The encoded protein and RalA are both essential for proper kinetochore-microtubule function in early mitosis. This protein has been shown to be a biomark
miRNA miRNA information provided by mirtarbase database.
1204
miRTarBase ID miRNA Experiments Reference
MIRT021351 hsa-miR-9-5p Microarray 17612493
MIRT022250 hsa-miR-124-3p Proteomics;Microarray 18668037
MIRT023502 hsa-miR-1-3p Proteomics 18668040
MIRT025685 hsa-miR-7-5p Microarray 17612493
MIRT049492 hsa-miR-92a-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
45
GO ID Ontology Definition Evidence Reference
GO:0000775 Component Chromosome, centromeric region IEA
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0005085 Function Guanyl-nucleotide exchange factor activity IEA
GO:0005515 Function Protein binding IPI 22282019, 25074804
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609587 30297 ENSG00000179051
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9P258
Protein name Protein RCC2 (RCC1-like protein TD-60) (Telophase disk protein of 60 kDa)
Protein function Multifunctional protein that may affect its functions by regulating the activity of small GTPases, such as RAC1 and RALA (PubMed:12919680, PubMed:25074804, PubMed:26158537, PubMed:28869598). Required for normal progress through the cell cycle, b
PDB 5GWN
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00415 RCC1 168 217 Regulator of chromosome condensation (RCC1) repeat Repeat
PF00415 RCC1 220 269 Regulator of chromosome condensation (RCC1) repeat Repeat
PF00415 RCC1 272 345 Regulator of chromosome condensation (RCC1) repeat Repeat
PF00415 RCC1 349 399 Regulator of chromosome condensation (RCC1) repeat Repeat
Sequence
MPRKKAAAAAWEEPSSGNGTARAGPRKRGGPAGRKRERPERCSSSSGGGSSGDEDGLELD
GAPGGGKRAARPATAGKAGGAAVVITEPEHTKERVKLEGSKCKGQLLIFGATNWDLIGRK
EVPKQQAAYRNLGQNLWGPHRYGCLAGVRVRTVVSGSCAAHSLLITTEGKLWSWGRNEKG
QLGHGDTKRVEAPRLIEGLSHEVIVSAACGRNHTLAL
TETGSVFAFGENKMGQLGLGNQT
DAVPSPAQIMYNGQPITKMACGAEFSMIM
DCKGNLYSFGCPEYGQLGHNSDGKFIARAQR
IEYDCELVPRRVAIFIEKTKDGQILPVPNVVVRDVACGANHTLVL
DSQKRVFSWGFGGYG
RLGHAEQKDEMVPRLVKLFDFPGRGASQIYAGYTCSFAV
SEVGGLFFWGATNTSRESTMY
PKAVQDLCGWRIRSLACGKSSIIVAADESTISWGPSPTFGELGYGDHKPKSSTAAQEVKT
LDGIFSEQVAMGYSHSLVIARDESETEKEKIKKLPEYNPRTL
Sequence length 522
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Separation of Sister Chromatids
Resolution of Sister Chromatid Cohesion
RHO GTPases Activate Formins
Mitotic Prometaphase
EML4 and NUDC in mitotic spindle formation
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Lung cancer Uncertain significance rs749301831 RCV005930759
Prostate cancer Uncertain significance rs864622010 RCV000204199
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 33170908
Carcinogenesis Associate 36441563
Colorectal Neoplasms Associate 25910952, 33219056
Glioma Associate 36116740
Leukemia Myeloid Acute Associate 35217832
Lung Neoplasms Stimulate 29321004
Lung Neoplasms Associate 29913439
Lymphatic Metastasis Associate 38008751
Melanoma Associate 24188633
Microsatellite Instability Associate 25910952