EAF2 (ELL associated factor 2)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
55840
Gene name Gene Name - the full gene name approved by the HGNC.
ELL associated factor 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
EAF2
Synonyms (NCBI Gene) Gene synonyms aliases
BM040, TRAITS, U19
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q13.33
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(3)
miRTarBase ID miRNA Experiments Reference
MIRT024640 hsa-miR-215-5p Microarray 19074876
MIRT026244 hsa-miR-192-5p Microarray 19074876
MIRT029057 hsa-miR-26b-5p Microarray 19088304
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(2)
Transcription factor Regulation Reference
PML Repression 18089734
TFPT Repression 17395368
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(11)
GO ID Ontology Definition Evidence Reference
GO:0003711 Function Transcription elongation regulator activity IMP 32087315
GO:0005515 Function Protein binding IPI 17395368, 21516116, 24421387, 25416956, 27107012, 32296183
GO:0005654 Component Nucleoplasm TAS
GO:0006366 Process Transcription by RNA polymerase II TAS
GO:0006368 Process Transcription elongation from RNA polymerase II promoter TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
607659 23115 ENSG00000145088
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q96CJ1
Protein name ELL-associated factor 2 (Testosterone-regulated apoptosis inducer and tumor suppressor protein)
Protein function Acts as a transcriptional transactivator of TCEA1 elongation activity (By similarity). Acts as a transcriptional transactivator of ELL and ELL2 elongation activities. Potent inducer of apoptosis in prostatic and non-prostatic cell lines. Inhibit
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09816 EAF 16 → 115 RNA polymerase II transcription elongation factor Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in heart, brain, placenta, lung, skeletal muscle, kidney, pancreas, spleen, prostate, testis, small intestine, colon, adrenal, bone marrow, lymph node, spinal gland, stomach, thyroid, trachea, thymus, liver and leukocytes. {E
Sequence 
MNSAAGFSHLDRRERVLKLGESFEKQPRCAFHTVRYDFKPASIDTSSEGYLEVGEGEQVT
ITLPNIEGSTPPVTVFKGSKKPYLKECILIINHDTGECRLEKLSSNITVKKTRVEGSSKI
QYRKEQQQQQMWNSARTPNLVKHSPSEDKMSPASPIDDIERELKAEASLMDQMSSCDSSS
DSKSSSSSSSEDSSSDSEDEDCKSSTSDTGNCVSGHPTMTQYRIPDIDASHNRFRDNSGL
LMNTLRNDLQLSESGSDSDD
Sequence length 260
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Formation of RNA Pol II elongation complex
RNA Polymerase II Pre-transcription Events
RNA Polymerase II Transcription Elongation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (2)
Causal
Disease term Disease name dbSNP ID References
Lung cancer Malignant neoplasm of lung rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135 20564326
Prostate cancer Malignant neoplasm of prostate rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582 20564326
Show/Hide Text Mining Associations (17)
Associations from Text Mining
Disease Name Relationship Type References
Autoimmune Diseases Associate 36267464
Cataract Associate 29257273
Colorectal Neoplasms Inhibit 37426316
Hypoxia Associate 20166137, 24421387
Hypoxia Brain Associate 24421387
Inflammation Associate 36267464
Leukemia Associate 20166137
Lymphoma Large B Cell Diffuse Associate 25267198
Neoplasm Metastasis Inhibit 26895851
Neoplasms Inhibit 17044034, 24272884, 24421387, 26895851, 27058417, 29257273, 30009504, 37426316