Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
55840
Gene name Gene Name - the full gene name approved by the HGNC.
ELL associated factor 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
EAF2
Synonyms (NCBI Gene) Gene synonyms aliases
BM040, TRAITS, U19
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q13.33
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT024640 hsa-miR-215-5p Microarray 19074876
MIRT026244 hsa-miR-192-5p Microarray 19074876
MIRT029057 hsa-miR-26b-5p Microarray 19088304
Transcription factors
Transcription factor Regulation Reference
PML Repression 18089734
TFPT Repression 17395368
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003711 Function Transcription elongation factor activity IBA
GO:0003711 Function Transcription elongation factor activity IMP 32087315
GO:0005515 Function Protein binding IPI 17395368, 21516116, 24421387, 25416956, 27107012, 32296183
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607659 23115 ENSG00000145088
Protein
UniProt ID Q96CJ1
Protein name ELL-associated factor 2 (Testosterone-regulated apoptosis inducer and tumor suppressor protein)
Protein function Acts as a transcriptional transactivator of TCEA1 elongation activity (By similarity). Acts as a transcriptional transactivator of ELL and ELL2 elongation activities. Potent inducer of apoptosis in prostatic and non-prostatic cell lines. Inhibit
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09816 EAF 16 115 RNA polymerase II transcription elongation factor Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in heart, brain, placenta, lung, skeletal muscle, kidney, pancreas, spleen, prostate, testis, small intestine, colon, adrenal, bone marrow, lymph node, spinal gland, stomach, thyroid, trachea, thymus, liver and leukocytes. {E
Sequence
MNSAAGFSHLDRRERVLKLGESFEKQPRCAFHTVRYDFKPASIDTSSEGYLEVGEGEQVT
ITLPNIEGSTPPVTVFKGSKKPYLKECILIINHDTGECRLEKLSSNITVKKTRVE
GSSKI
QYRKEQQQQQMWNSARTPNLVKHSPSEDKMSPASPIDDIERELKAEASLMDQMSSCDSSS
DSKSSSSSSSEDSSSDSEDEDCKSSTSDTGNCVSGHPTMTQYRIPDIDASHNRFRDNSGL
LMNTLRNDLQLSESGSDSDD
Sequence length 260
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Formation of RNA Pol II elongation complex
RNA Polymerase II Pre-transcription Events
RNA Polymerase II Transcription Elongation
<