EAF2 (ELL associated factor 2)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID 55840
Gene name ELL associated factor 2
Gene symbol EAF2
Synonyms (NCBI Gene)
BM040TRAITSU19
Chromosome 3
Chromosome location 3q13.33
miRNA miRNA information provided by mirtarbase database.
3
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (3)
miRTarBase ID miRNA Experiments Reference
MIRT024640 hsa-miR-215-5p Microarray 19074876
MIRT026244 hsa-miR-192-5p Microarray 19074876
MIRT029057 hsa-miR-26b-5p Microarray 19088304
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (2)
Transcription factor Regulation Reference
PML Repression 18089734
TFPT Repression 17395368
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
19
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (19)
GO ID Ontology Definition Evidence Reference
GO:0003711 Function Transcription elongation factor activity IBA
GO:0003711 Function Transcription elongation factor activity IMP 32087315
GO:0005515 Function Protein binding IPI 17395368, 21516116, 24421387, 25416956, 27107012, 32296183
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
607659 23115 ENSG00000145088
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96CJ1
Protein name ELL-associated factor 2 (Testosterone-regulated apoptosis inducer and tumor suppressor protein)
Protein function Acts as a transcriptional transactivator of TCEA1 elongation activity (By similarity). Acts as a transcriptional transactivator of ELL and ELL2 elongation activities. Potent inducer of apoptosis in prostatic and non-prostatic cell lines. Inhibit
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09816 EAF 16 → 115 RNA polymerase II transcription elongation factor Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in heart, brain, placenta, lung, skeletal muscle, kidney, pancreas, spleen, prostate, testis, small intestine, colon, adrenal, bone marrow, lymph node, spinal gland, stomach, thyroid, trachea, thymus, liver and leukocytes. {E
Sequence 
MNSAAGFSHLDRRERVLKLGESFEKQPRCAFHTVRYDFKPASIDTSSEGYLEVGEGEQVT
ITLPNIEGSTPPVTVFKGSKKPYLKECILIINHDTGECRLEKLSSNITVKKTRVEGSSKI
QYRKEQQQQQMWNSARTPNLVKHSPSEDKMSPASPIDDIERELKAEASLMDQMSSCDSSS
DSKSSSSSSSEDSSSDSEDEDCKSSTSDTGNCVSGHPTMTQYRIPDIDASHNRFRDNSGL
LMNTLRNDLQLSESGSDSDD
Sequence length 260
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
  Reactome
    Formation of RNA Pol II elongation complex
RNA Polymerase II Pre-transcription Events
RNA Polymerase II Transcription Elongation