Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5583
Gene name Gene Name - the full gene name approved by the HGNC.	Protein kinase C eta
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PRKCH
Synonyms (NCBI Gene) Gene synonyms aliases	PKC-L, PKCL, PRKCL, nPKC-eta, uORF2
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q23.1
Summary Summary of gene provided in NCBI Entrez Gene.	Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs2230500	G>A	Risk-factor	Coding sequence variant, missense variant

Show/Hide all(296)

miRTarBase ID	miRNA	Experiments	Reference
MIRT723319	hsa-miR-216b-5p	HITS-CLIP	19536157
MIRT723318	hsa-miR-3675-3p	HITS-CLIP	19536157
MIRT723317	hsa-miR-3938	HITS-CLIP	19536157
MIRT723316	hsa-miR-3690	HITS-CLIP	19536157
MIRT723315	hsa-miR-4254	HITS-CLIP	19536157
MIRT723314	hsa-miR-6731-3p	HITS-CLIP	19536157
MIRT723313	hsa-miR-26a-1-3p	HITS-CLIP	19536157
MIRT723312	hsa-miR-26a-2-3p	HITS-CLIP	19536157
MIRT723311	hsa-miR-4434	HITS-CLIP	19536157
MIRT723310	hsa-miR-4516	HITS-CLIP	19536157
MIRT723309	hsa-miR-5703	HITS-CLIP	19536157
MIRT723308	hsa-miR-1343-3p	HITS-CLIP	19536157
MIRT723307	hsa-miR-6783-3p	HITS-CLIP	19536157
MIRT723306	hsa-miR-4531	HITS-CLIP	19536157
MIRT439896	hsa-miR-376c-3p	HITS-CLIP	19536157
MIRT439900	hsa-miR-493-3p	HITS-CLIP	24374217
MIRT439899	hsa-miR-376a-3p	HITS-CLIP	24374217
MIRT439898	hsa-miR-432-5p	HITS-CLIP	24374217
MIRT439896	hsa-miR-376c-3p	HITS-CLIP	24374217
MIRT439900	hsa-miR-493-3p	HITS-CLIP	24374217
MIRT439899	hsa-miR-376a-3p	HITS-CLIP	24374217
MIRT439898	hsa-miR-432-5p	HITS-CLIP	24374217
MIRT439896	hsa-miR-376c-3p	HITS-CLIP	24374217
MIRT732350	hsa-miR-24-3p	Luciferase reporter assay, qRT-PCR, Western blot	27351203
MIRT732350	hsa-miR-24-3p	Luciferase reporter assay, qRT-PCR, Western blot	27351203
MIRT723319	hsa-miR-216b-5p	HITS-CLIP	19536157
MIRT723318	hsa-miR-3675-3p	HITS-CLIP	19536157
MIRT723317	hsa-miR-3938	HITS-CLIP	19536157
MIRT723316	hsa-miR-3690	HITS-CLIP	19536157
MIRT723315	hsa-miR-4254	HITS-CLIP	19536157
MIRT723314	hsa-miR-6731-3p	HITS-CLIP	19536157
MIRT723313	hsa-miR-26a-1-3p	HITS-CLIP	19536157
MIRT723312	hsa-miR-26a-2-3p	HITS-CLIP	19536157
MIRT723311	hsa-miR-4434	HITS-CLIP	19536157
MIRT723310	hsa-miR-4516	HITS-CLIP	19536157
MIRT723309	hsa-miR-5703	HITS-CLIP	19536157
MIRT723308	hsa-miR-1343-3p	HITS-CLIP	19536157
MIRT723307	hsa-miR-6783-3p	HITS-CLIP	19536157
MIRT723306	hsa-miR-4531	HITS-CLIP	19536157
MIRT439896	hsa-miR-376c-3p	HITS-CLIP	19536157
MIRT1263252	hsa-miR-1253	CLIP-seq
MIRT1263253	hsa-miR-1283	CLIP-seq
MIRT1263254	hsa-miR-221	CLIP-seq
MIRT1263255	hsa-miR-222	CLIP-seq
MIRT1263256	hsa-miR-27a	CLIP-seq
MIRT1263257	hsa-miR-27b	CLIP-seq
MIRT1263258	hsa-miR-3185	CLIP-seq
MIRT1263259	hsa-miR-3614-5p	CLIP-seq
MIRT1263260	hsa-miR-3677-5p	CLIP-seq
MIRT1263261	hsa-miR-411	CLIP-seq
MIRT1263262	hsa-miR-412	CLIP-seq
MIRT1263263	hsa-miR-4268	CLIP-seq
MIRT1263264	hsa-miR-4274	CLIP-seq
MIRT1263265	hsa-miR-4448	CLIP-seq
MIRT1263266	hsa-miR-4481	CLIP-seq
MIRT1263267	hsa-miR-4635	CLIP-seq
MIRT1263268	hsa-miR-4698	CLIP-seq
MIRT1263269	hsa-miR-4729	CLIP-seq
MIRT1263270	hsa-miR-4745-5p	CLIP-seq
MIRT1263271	hsa-miR-4758-5p	CLIP-seq
MIRT1263272	hsa-miR-4797-5p	CLIP-seq
MIRT1263273	hsa-miR-493	CLIP-seq
MIRT1263274	hsa-miR-508-5p	CLIP-seq
MIRT1263275	hsa-miR-513a-5p	CLIP-seq
MIRT1263276	hsa-miR-548ag	CLIP-seq
MIRT1263277	hsa-miR-548ai	CLIP-seq
MIRT1263278	hsa-miR-548v	CLIP-seq
MIRT1263279	hsa-miR-574-3p	CLIP-seq
MIRT1263280	hsa-miR-578	CLIP-seq
MIRT1263281	hsa-miR-586	CLIP-seq
MIRT2077478	hsa-miR-185	CLIP-seq
MIRT2077479	hsa-miR-186	CLIP-seq
MIRT2077480	hsa-miR-1912	CLIP-seq
MIRT2077481	hsa-miR-2682	CLIP-seq
MIRT1263256	hsa-miR-27a	CLIP-seq
MIRT1263257	hsa-miR-27b	CLIP-seq
MIRT2077482	hsa-miR-3130-5p	CLIP-seq
MIRT2077483	hsa-miR-3133	CLIP-seq
MIRT2077484	hsa-miR-3654	CLIP-seq
MIRT2077485	hsa-miR-383	CLIP-seq
MIRT1263261	hsa-miR-411	CLIP-seq
MIRT2077486	hsa-miR-4306	CLIP-seq
MIRT2077487	hsa-miR-4420	CLIP-seq
MIRT2077488	hsa-miR-4482	CLIP-seq
MIRT2077489	hsa-miR-449c	CLIP-seq
MIRT2077490	hsa-miR-4520a-3p	CLIP-seq
MIRT2077491	hsa-miR-4638-3p	CLIP-seq
MIRT2077492	hsa-miR-4644	CLIP-seq
MIRT1263268	hsa-miR-4698	CLIP-seq
MIRT2077493	hsa-miR-4726-3p	CLIP-seq
MIRT1263269	hsa-miR-4729	CLIP-seq
MIRT1263274	hsa-miR-508-5p	CLIP-seq
MIRT2077494	hsa-miR-509-3p	CLIP-seq
MIRT2077495	hsa-miR-5096	CLIP-seq
MIRT1263275	hsa-miR-513a-5p	CLIP-seq
MIRT1263281	hsa-miR-586	CLIP-seq
MIRT2077496	hsa-miR-656	CLIP-seq
MIRT2077497	hsa-miR-940	CLIP-seq
MIRT2077484	hsa-miR-3654	CLIP-seq
MIRT2304035	hsa-miR-377	CLIP-seq
MIRT1263262	hsa-miR-412	CLIP-seq
MIRT2077487	hsa-miR-4420	CLIP-seq
MIRT2077490	hsa-miR-4520a-3p	CLIP-seq
MIRT1263267	hsa-miR-4635	CLIP-seq
MIRT2077491	hsa-miR-4638-3p	CLIP-seq
MIRT2304036	hsa-miR-4755-5p	CLIP-seq
MIRT2077495	hsa-miR-5096	CLIP-seq
MIRT2393027	hsa-miR-3183	CLIP-seq
MIRT2393028	hsa-miR-4290	CLIP-seq
MIRT2393029	hsa-miR-4723-3p	CLIP-seq
MIRT2393030	hsa-miR-483-3p	CLIP-seq
MIRT2600948	hsa-miR-1248	CLIP-seq
MIRT2077479	hsa-miR-186	CLIP-seq
MIRT2077480	hsa-miR-1912	CLIP-seq
MIRT2600949	hsa-miR-205	CLIP-seq
MIRT2600950	hsa-miR-214	CLIP-seq
MIRT2600951	hsa-miR-216a	CLIP-seq
MIRT2600952	hsa-miR-24	CLIP-seq
MIRT2077481	hsa-miR-2682	CLIP-seq
MIRT1263256	hsa-miR-27a	CLIP-seq
MIRT1263257	hsa-miR-27b	CLIP-seq
MIRT2600953	hsa-miR-3121-3p	CLIP-seq
MIRT2077482	hsa-miR-3130-5p	CLIP-seq
MIRT2077483	hsa-miR-3133	CLIP-seq
MIRT2600954	hsa-miR-3163	CLIP-seq
MIRT2600955	hsa-miR-3170	CLIP-seq
MIRT2600956	hsa-miR-3200-5p	CLIP-seq
MIRT2600957	hsa-miR-34a	CLIP-seq
MIRT2600958	hsa-miR-34c-5p	CLIP-seq
MIRT1263259	hsa-miR-3614-5p	CLIP-seq
MIRT2600959	hsa-miR-3619-5p	CLIP-seq
MIRT2600960	hsa-miR-3653	CLIP-seq
MIRT2077484	hsa-miR-3654	CLIP-seq
MIRT2600961	hsa-miR-3658	CLIP-seq
MIRT2600962	hsa-miR-3663-3p	CLIP-seq
MIRT1263260	hsa-miR-3677-5p	CLIP-seq
MIRT2600963	hsa-miR-3688-5p	CLIP-seq
MIRT2600964	hsa-miR-371-3p	CLIP-seq
MIRT2600965	hsa-miR-371b-3p	CLIP-seq
MIRT2304035	hsa-miR-377	CLIP-seq
MIRT2600966	hsa-miR-378	CLIP-seq
MIRT2600967	hsa-miR-378b	CLIP-seq
MIRT2600968	hsa-miR-378c	CLIP-seq
MIRT2600969	hsa-miR-378d	CLIP-seq
MIRT2600970	hsa-miR-378e	CLIP-seq
MIRT2600971	hsa-miR-378f	CLIP-seq
MIRT2600972	hsa-miR-378h	CLIP-seq
MIRT2600973	hsa-miR-378i	CLIP-seq
MIRT2077485	hsa-miR-383	CLIP-seq
MIRT1263262	hsa-miR-412	CLIP-seq
MIRT2600974	hsa-miR-422a	CLIP-seq
MIRT2600975	hsa-miR-4269	CLIP-seq
MIRT2600976	hsa-miR-4276	CLIP-seq
MIRT2600977	hsa-miR-4284	CLIP-seq
MIRT2600978	hsa-miR-4293	CLIP-seq
MIRT2600979	hsa-miR-4330	CLIP-seq
MIRT2077487	hsa-miR-4420	CLIP-seq
MIRT2600980	hsa-miR-4446-5p	CLIP-seq
MIRT2600981	hsa-miR-4452	CLIP-seq
MIRT2600982	hsa-miR-4469	CLIP-seq
MIRT2600983	hsa-miR-4474-3p	CLIP-seq
MIRT1263266	hsa-miR-4481	CLIP-seq
MIRT2077488	hsa-miR-4482	CLIP-seq
MIRT2600984	hsa-miR-449a	CLIP-seq
MIRT2600985	hsa-miR-449b	CLIP-seq
MIRT2077489	hsa-miR-449c	CLIP-seq
MIRT2600986	hsa-miR-4514	CLIP-seq
MIRT2077490	hsa-miR-4520a-3p	CLIP-seq
MIRT2600987	hsa-miR-4528	CLIP-seq
MIRT1263267	hsa-miR-4635	CLIP-seq
MIRT2077491	hsa-miR-4638-3p	CLIP-seq
MIRT2600988	hsa-miR-4659a-5p	CLIP-seq
MIRT2600989	hsa-miR-4659b-5p	CLIP-seq
MIRT2600990	hsa-miR-4668-3p	CLIP-seq
MIRT2600991	hsa-miR-4690-5p	CLIP-seq
MIRT2600992	hsa-miR-4692	CLIP-seq
MIRT2600993	hsa-miR-4725-5p	CLIP-seq
MIRT2077493	hsa-miR-4726-3p	CLIP-seq
MIRT1263270	hsa-miR-4745-5p	CLIP-seq
MIRT2600994	hsa-miR-4755-3p	CLIP-seq
MIRT2304036	hsa-miR-4755-5p	CLIP-seq
MIRT1263271	hsa-miR-4758-5p	CLIP-seq
MIRT2600995	hsa-miR-4760-3p	CLIP-seq
MIRT2600996	hsa-miR-4766-5p	CLIP-seq
MIRT1263272	hsa-miR-4797-5p	CLIP-seq
MIRT2600997	hsa-miR-4799-5p	CLIP-seq
MIRT2600998	hsa-miR-504	CLIP-seq
MIRT2077494	hsa-miR-509-3p	CLIP-seq
MIRT2077495	hsa-miR-5096	CLIP-seq
MIRT1263275	hsa-miR-513a-5p	CLIP-seq
MIRT2600999	hsa-miR-515-3p	CLIP-seq
MIRT2601000	hsa-miR-519e	CLIP-seq
MIRT1263279	hsa-miR-574-3p	CLIP-seq
MIRT1263280	hsa-miR-578	CLIP-seq
MIRT2601001	hsa-miR-581	CLIP-seq
MIRT2601002	hsa-miR-593	CLIP-seq
MIRT2601003	hsa-miR-642a	CLIP-seq
MIRT2601004	hsa-miR-761	CLIP-seq
MIRT2077497	hsa-miR-940	CLIP-seq
MIRT2601005	hsa-miR-943	CLIP-seq
MIRT2600948	hsa-miR-1248	CLIP-seq
MIRT2077479	hsa-miR-186	CLIP-seq
MIRT2077480	hsa-miR-1912	CLIP-seq
MIRT2600949	hsa-miR-205	CLIP-seq
MIRT2600950	hsa-miR-214	CLIP-seq
MIRT2600951	hsa-miR-216a	CLIP-seq
MIRT2600952	hsa-miR-24	CLIP-seq
MIRT2077481	hsa-miR-2682	CLIP-seq
MIRT1263256	hsa-miR-27a	CLIP-seq
MIRT1263257	hsa-miR-27b	CLIP-seq
MIRT2600953	hsa-miR-3121-3p	CLIP-seq
MIRT2077482	hsa-miR-3130-5p	CLIP-seq
MIRT2077483	hsa-miR-3133	CLIP-seq
MIRT2600954	hsa-miR-3163	CLIP-seq
MIRT2600955	hsa-miR-3170	CLIP-seq
MIRT2600956	hsa-miR-3200-5p	CLIP-seq
MIRT2600957	hsa-miR-34a	CLIP-seq
MIRT2600958	hsa-miR-34c-5p	CLIP-seq
MIRT2688633	hsa-miR-3611	CLIP-seq
MIRT2600959	hsa-miR-3619-5p	CLIP-seq
MIRT2600960	hsa-miR-3653	CLIP-seq
MIRT2077484	hsa-miR-3654	CLIP-seq
MIRT2600961	hsa-miR-3658	CLIP-seq
MIRT2600962	hsa-miR-3663-3p	CLIP-seq
MIRT1263260	hsa-miR-3677-5p	CLIP-seq
MIRT2600963	hsa-miR-3688-5p	CLIP-seq
MIRT2600964	hsa-miR-371-3p	CLIP-seq
MIRT2600965	hsa-miR-371b-3p	CLIP-seq
MIRT2600966	hsa-miR-378	CLIP-seq
MIRT2600967	hsa-miR-378b	CLIP-seq
MIRT2600968	hsa-miR-378c	CLIP-seq
MIRT2600969	hsa-miR-378d	CLIP-seq
MIRT2600970	hsa-miR-378e	CLIP-seq
MIRT2600971	hsa-miR-378f	CLIP-seq
MIRT2600972	hsa-miR-378h	CLIP-seq
MIRT2600973	hsa-miR-378i	CLIP-seq
MIRT2077485	hsa-miR-383	CLIP-seq
MIRT2600974	hsa-miR-422a	CLIP-seq
MIRT2600975	hsa-miR-4269	CLIP-seq
MIRT2600976	hsa-miR-4276	CLIP-seq
MIRT2600977	hsa-miR-4284	CLIP-seq
MIRT2600978	hsa-miR-4293	CLIP-seq
MIRT2600979	hsa-miR-4330	CLIP-seq
MIRT2077487	hsa-miR-4420	CLIP-seq
MIRT2600981	hsa-miR-4452	CLIP-seq
MIRT2600982	hsa-miR-4469	CLIP-seq
MIRT2600983	hsa-miR-4474-3p	CLIP-seq
MIRT1263266	hsa-miR-4481	CLIP-seq
MIRT2077488	hsa-miR-4482	CLIP-seq
MIRT2600984	hsa-miR-449a	CLIP-seq
MIRT2600985	hsa-miR-449b	CLIP-seq
MIRT2077489	hsa-miR-449c	CLIP-seq
MIRT2600986	hsa-miR-4514	CLIP-seq
MIRT2077490	hsa-miR-4520a-3p	CLIP-seq
MIRT2600987	hsa-miR-4528	CLIP-seq
MIRT1263267	hsa-miR-4635	CLIP-seq
MIRT2077491	hsa-miR-4638-3p	CLIP-seq
MIRT2600988	hsa-miR-4659a-5p	CLIP-seq
MIRT2600989	hsa-miR-4659b-5p	CLIP-seq
MIRT2600990	hsa-miR-4668-3p	CLIP-seq
MIRT2600991	hsa-miR-4690-5p	CLIP-seq
MIRT2600992	hsa-miR-4692	CLIP-seq
MIRT2600993	hsa-miR-4725-5p	CLIP-seq
MIRT2077493	hsa-miR-4726-3p	CLIP-seq
MIRT1263270	hsa-miR-4745-5p	CLIP-seq
MIRT2600994	hsa-miR-4755-3p	CLIP-seq
MIRT1263271	hsa-miR-4758-5p	CLIP-seq
MIRT2600995	hsa-miR-4760-3p	CLIP-seq
MIRT2600996	hsa-miR-4766-5p	CLIP-seq
MIRT2600997	hsa-miR-4799-5p	CLIP-seq
MIRT2600998	hsa-miR-504	CLIP-seq
MIRT2077494	hsa-miR-509-3p	CLIP-seq
MIRT2077495	hsa-miR-5096	CLIP-seq
MIRT1263275	hsa-miR-513a-5p	CLIP-seq
MIRT2600999	hsa-miR-515-3p	CLIP-seq
MIRT2601000	hsa-miR-519e	CLIP-seq
MIRT2688634	hsa-miR-548a-5p	CLIP-seq
MIRT2688635	hsa-miR-548ab	CLIP-seq
MIRT2688636	hsa-miR-548ak	CLIP-seq
MIRT2688637	hsa-miR-548b-5p	CLIP-seq
MIRT2688638	hsa-miR-548c-5p	CLIP-seq
MIRT2688639	hsa-miR-548d-5p	CLIP-seq
MIRT2688640	hsa-miR-548h	CLIP-seq
MIRT2688641	hsa-miR-548i	CLIP-seq
MIRT2688642	hsa-miR-548j	CLIP-seq
MIRT2688643	hsa-miR-548w	CLIP-seq
MIRT2688644	hsa-miR-548y	CLIP-seq
MIRT2688645	hsa-miR-559	CLIP-seq
MIRT1263279	hsa-miR-574-3p	CLIP-seq
MIRT1263280	hsa-miR-578	CLIP-seq
MIRT2601001	hsa-miR-581	CLIP-seq
MIRT2601002	hsa-miR-593	CLIP-seq
MIRT2601003	hsa-miR-642a	CLIP-seq
MIRT2601004	hsa-miR-761	CLIP-seq
MIRT2077497	hsa-miR-940	CLIP-seq
MIRT2601005	hsa-miR-943	CLIP-seq

Show/Hide all(52)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IDA	34593629
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004697	Function	Diacylglycerol-dependent serine/threonine kinase activity	IEA
GO:0004697	Function	Diacylglycerol-dependent serine/threonine kinase activity	TAS	1986216
GO:0004699	Function	Diacylglycerol-dependent, calcium-independent serine/threonine kinase activity	IEA
GO:0004860	Function	Protein kinase inhibitor activity	IEA
GO:0005515	Function	Protein binding	IPI	19114660, 34593629
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IDA	15632189
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	15632189
GO:0005886	Component	Plasma membrane	IEA
GO:0005911	Component	Cell-cell junction	IEA
GO:0006417	Process	Regulation of translation	IEA
GO:0006468	Process	Protein phosphorylation	IMP	22304920
GO:0006468	Process	Protein phosphorylation	TAS	1986216
GO:0007165	Process	Signal transduction	TAS	1986216
GO:0008270	Function	Zinc ion binding	IEA
GO:0010744	Process	Positive regulation of macrophage derived foam cell differentiation	IEA
GO:0010744	Process	Positive regulation of macrophage derived foam cell differentiation	ISS
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0017148	Process	Negative regulation of translation	IDA	19797084
GO:0017148	Process	Negative regulation of translation	IMP	34593629
GO:0019899	Function	Enzyme binding	IPI	15632189
GO:0030154	Process	Cell differentiation	IEA
GO:0030291	Function	Protein serine/threonine kinase inhibitor activity	IDA	34593629
GO:0031267	Function	Small GTPase binding	IEA
GO:0032056	Process	Positive regulation of translation in response to stress	IDA	19797084
GO:0034198	Process	Cellular response to amino acid starvation	IDA	19797084
GO:0034351	Process	Negative regulation of glial cell apoptotic process	IMP	11772428
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0045182	Function	Translation regulator activity	IDA	19797084
GO:0045618	Process	Positive regulation of keratinocyte differentiation	IEA
GO:0045618	Process	Positive regulation of keratinocyte differentiation	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0050861	Process	Positive regulation of B cell receptor signaling pathway	IMP	18780722
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IMP	21820409
GO:0060252	Process	Positive regulation of glial cell proliferation	IMP	10806212
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0120283	Function	Protein serine/threonine kinase binding	IPI	34593629
GO:0141212	Process	Phospholipase C/protein kinase C signal transduction	IEA
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	IEA
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	TAS	22732145
GO:2000810	Process	Regulation of bicellular tight junction assembly	IMP	19114660

MIM	HGNC	e!Ensembl
605437	9403	ENSG00000027075

Protein

UniProt ID

P24723

Protein name

Protein kinase C eta type (EC 2.7.11.13) (PKC-L) (nPKC-eta)

Protein function

Calcium-independent, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine-protein kinase that is involved in the regulation of cell differentiation in keratinocytes and pre-B cell receptor, mediates regulation of epithelial tight ju

PDB

2FK9 , 3TXO , 8FP1 , 8FP3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00168	C2	10 → 124	C2 domain	Domain
PF00130	C1_1	172 → 225	Phorbol esters/diacylglycerol binding domain (C1 domain)	Domain
PF00130	C1_1	246 → 298	Phorbol esters/diacylglycerol binding domain (C1 domain)	Domain
PF00069	Pkinase	355 → 614	Protein kinase domain	Domain
PF00433	Pkinase_C	635 → 676	Protein kinase C terminal domain	Family

Tissue specificity

TISSUE SPECIFICITY: Most abundant in lung, less in heart and skin. {ECO:0000269|PubMed:1986216}.

Sequence

MSSGTMKFNGYLRVRIGEAVGLQPTRWSLRHSLFKKGHQLLDPYLTVSVDQVRVGQTSTK
QKTNKPTYNEEFCANVTDGGHLELAVFHETPLGYDHFVANCTLQFQELLRTTGASDTFEG
WVDLEPEGKVFVVITLTGSFTEATLQRDRIFKHFTRKRQRAMRRRVHQINGHKFMATYLR
QPTYCSHCREFIWGVFGKQGYQCQVCTCVVHKRCHHLIVTACTCQNNINKVDSKIAEQRF
GINIPHKFSIHNYKVPTFCDHCGSLLWGIMRQGLQCKICKMNVHIRCQANVAPNCGVNAV
ELAKTLAGMGLQPGNISPTSKLVSRSTLRRQGKESSKEGNGIGVNSSNRLGIDNFEFIRV
LGKGSFGKVMLARVKETGDLYAVKVLKKDVILQDDDVECTMTEKRILSLARNHPFLTQLF
CCFQTPDRLFFVMEFVNGGDLMFHIQKSRRFDEARARFYAAEIISALMFLHDKGIIYRDL
KLDNVLLDHEGHCKLADFGMCKEGICNGVTTATFCGTPDYIAPEILQEMLYGPAVDWWAM
GVLLYEMLCGHAPFEAENEDDLFEAILNDEVVYPTWLHEDATGILKSFMTKNPTMRLGSL
TQGGEHAILRHPFFKEIDWAQLNHRQIEPPFRPRIKSREDVSNFDPDFIKEEPVLTPIDE
GHLPMINQDEFRNFSYVSPELQP

Sequence length

683

UniProt ID

C0HM02

Protein name

PRKCH upstream open reading frame 2 (uORF2) (Protein uPEP2)

Protein function

Product of an upstream open reading frame (ORF) of PRKCH which regulates translation of the downstream protein kinase C eta (PKC-eta) ORF (PubMed:19797084, PubMed:34593629). Functions as a repressive element that maintains low basal levels of PK

Family and domains

Interactions

View interactions

	KEGG		Reactome
	Vascular smooth muscle contraction Inflammatory mediator regulation of TRP channels		Effects of PIP2 hydrolysis

Show/Hide Unknown Diseases (5)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Asthma	Asthma	N/A	N/A	GWAS
Cerebral Infarction	Cerebral infarction, susceptibility to	N/A	N/A	ClinVar
Myocardial Infarction	Myocardial infarction	N/A	N/A	GWAS
Prostate cancer	Prostate cancer	N/A	N/A	GWAS
Rheumatoid arthritis	Rheumatoid arthritis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (21)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Alzheimer Disease	Associate	33797837, 40591711
Amelogenesis imperfecta hypoplastic hypomaturation X linked 1	Associate	37563801
Arthritis Rheumatoid	Associate	17195206, 31875586
Astrocytoma	Associate	10806212
Carcinoma Adenoid Cystic	Associate	27351203
Carcinoma Hepatocellular	Associate	31215439
Cerebral Hemorrhage	Associate	22808203
Cerebral Infarction	Associate	22808203, 24664524, 25900926
Essential Hypertension	Associate	28640647
Fibrosis	Associate	33860118
Glioblastoma	Associate	11772428
Hypertension	Associate	22808203
Keratosis Seborrheic	Associate	8245514
Menopause Premature	Associate	33860118
Neoplasms	Associate	1545811, 27351203
Non alcoholic Fatty Liver Disease	Associate	33860118
Obesity	Associate	23563609
Osteoarthritis	Associate	35352613
Skin Diseases	Associate	8245514
Stroke	Associate	22808203
Stroke Lacunar	Associate	25900926

PRKCH (protein kinase C eta)