Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
55722
Gene name Gene Name - the full gene name approved by the HGNC.
Centrosomal protein 72
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CEP72
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5p15.33
Summary Summary of gene provided in NCBI Entrez Gene.
The product of this gene is a member of the leucine-rich-repeat (LRR) superfamily of proteins. The protein is localized to the centrosome, a non-membraneous organelle that functions as the major microtubule-organizing center in animal cells. [provided by
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT005189 hsa-miR-30a-5p pSILAC 18668040
MIRT005189 hsa-miR-30a-5p Proteomics;Other 18668040
MIRT613558 hsa-miR-3166 HITS-CLIP 23824327
MIRT613558 hsa-miR-3166 HITS-CLIP 23824327
MIRT659575 hsa-miR-585-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16189514, 19447967, 19536135, 21078624, 21653829, 25416956, 26297806, 26638075, 26871637, 27107012, 28514442, 29892012, 31515488, 32296183, 32814053, 33961781
GO:0005737 Component Cytoplasm IEA
GO:0005813 Component Centrosome IDA 19536135, 21399614
GO:0005813 Component Centrosome IEA
GO:0005829 Component Cytosol IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
616475 25547 ENSG00000112877
Protein
UniProt ID Q9P209
Protein name Centrosomal protein of 72 kDa (Cep72)
Protein function Involved in the recruitment of key centrosomal proteins to the centrosome. Provides centrosomal microtubule-nucleation activity on the gamma-tubulin ring complexes (gamma-TuRCs) and has critical roles in forming a focused bipolar spindle, which
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14580 LRR_9 39 163 Repeat
Sequence
MARAGPRLVLSEEAVRAKSGLGPHRDLAELQSLSIPGTYQEKITHLGHSLMSLTGLKSLD
LSRNSLVSLEGIQYLTALESLNLYYNCISSLAEVFRLHALTELVDVDFRLNPVVKVEPDY
RLFVVHLLPKLQQLDDRPVRASERKASRLHFASEDSLDSKESV
PASLKEGRPHHPRAKCT
EALAKQSLVMDADDEAVLNLIAECEWDLGRPPGSTSFSQKGREADSRGSQESRHLLSPQL
VQYQCGDSGKQGRETRRSSCRGCCLEKMPWSQLCGELPPLYGAEPEASRAPRPHTYFTPH
PDSMDTEDSASSQKLDLSGEMVPGPLPAPGKCRKRRMPVGRFQTFSDQEGLGCPERTHGS
SVPKESLSRQDSSESRNGRTLSQPEASETEEQRSRGVTDTREPSPGSHSALPGKKTALQA
ALLETLLDLVDRSWGGCRSLHSNEAFLAQARHILSSVEEFTAAQDSSAMVGEDVGSLALE
SKSLQSRLAEQQQQHAREMSEVTAELHHTHKELDDLRQHLDKSLEENSRLKSLLLSMKKE
VKSADTAATLNLQIAGLQTSVKRLCGEIVELKQHLEHYDKIQELTQMLQESHSSLVSTNE
HLLQELSQVRAQHRAEVEQMHWSYQELKKTMALFPHSSASHGGCQAC
Sequence length 647
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Regulation of PLK1 Activity at G2/M Transition
Loss of Nlp from mitotic centrosomes
Recruitment of mitotic centrosome proteins and complexes
Loss of proteins required for interphase microtubule organization from the centrosome
Recruitment of NuMA to mitotic centrosomes
Anchoring of the basal body to the plasma membrane
AURKA Activation by TPX2
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Barrett esophagus Barrett's esophagus N/A N/A GWAS
Ulcerative colitis Ulcerative colitis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 29517860
Arthritis Rheumatoid Associate 20090771
Carcinoma Non Small Cell Lung Associate 29517860
Colitis Ulcerative Associate 27575496
Colorectal Neoplasms Associate 33431054
Cystic Disease Of Lung Associate 33253230
Cystic Fibrosis Associate 36921087
Glioma Associate 37349788
Hydrothorax Associate 29517860
Lung Diseases Associate 36921087