Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5566
Gene name Gene Name - the full gene name approved by the HGNC.	Protein kinase cAMP-activated catalytic subunit alpha
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PRKACA
Synonyms (NCBI Gene) Gene synonyms aliases	CAFD1, PKACA, PPNAD4
Disease Acronyms (UniProt) Disease acronyms from UniProt database	CAFD1, PPNAD4
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.12
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes one of the catalytic subunits of protein kinase A, which exists as a tetrameric holoenzyme with two regulatory subunits and two catalytic subunits, in its inactive form. cAMP causes the dissociation of the inactive holoenzyme into a dime

Show/Hide all(2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs386352352	A>C	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs724160013	->CAC	Pathogenic	Coding sequence variant, inframe insertion

Show/Hide all(391)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030635	hsa-miR-22-3p	Sequencing	20371350
MIRT044041	hsa-miR-365a-3p	CLASH	23622248
MIRT043455	hsa-miR-331-3p	CLASH	23622248
MIRT043455	hsa-miR-331-3p	CLASH	23622248
MIRT042660	hsa-miR-196b-5p	CLASH	23622248
MIRT037509	hsa-miR-744-5p	CLASH	23622248
MIRT732472	hsa-miR-1275	qRT-PCR	33910530
MIRT732472	hsa-miR-1275	qRT-PCR	33910530
MIRT1262219	hsa-miR-1225-3p	CLIP-seq
MIRT1262220	hsa-miR-1233	CLIP-seq
MIRT1262221	hsa-miR-1285	CLIP-seq
MIRT1262222	hsa-miR-1305	CLIP-seq
MIRT1262223	hsa-miR-15a	CLIP-seq
MIRT1262224	hsa-miR-15b	CLIP-seq
MIRT1262225	hsa-miR-16	CLIP-seq
MIRT1262226	hsa-miR-1915	CLIP-seq
MIRT1262227	hsa-miR-195	CLIP-seq
MIRT1262228	hsa-miR-2355-5p	CLIP-seq
MIRT1262229	hsa-miR-3074-5p	CLIP-seq
MIRT1262230	hsa-miR-3124-3p	CLIP-seq
MIRT1262231	hsa-miR-3126-3p	CLIP-seq
MIRT1262232	hsa-miR-3175	CLIP-seq
MIRT1262233	hsa-miR-3184	CLIP-seq
MIRT1262234	hsa-miR-3187-5p	CLIP-seq
MIRT1262235	hsa-miR-342-5p	CLIP-seq
MIRT1262236	hsa-miR-3671	CLIP-seq
MIRT1262237	hsa-miR-370	CLIP-seq
MIRT1262238	hsa-miR-378g	CLIP-seq
MIRT1262239	hsa-miR-423-5p	CLIP-seq
MIRT1262240	hsa-miR-424	CLIP-seq
MIRT1262241	hsa-miR-4254	CLIP-seq
MIRT1262242	hsa-miR-4307	CLIP-seq
MIRT1262243	hsa-miR-4308	CLIP-seq
MIRT1262244	hsa-miR-4424	CLIP-seq
MIRT1262245	hsa-miR-4447	CLIP-seq
MIRT1262246	hsa-miR-4472	CLIP-seq
MIRT1262247	hsa-miR-4486	CLIP-seq
MIRT1262248	hsa-miR-4514	CLIP-seq
MIRT1262249	hsa-miR-4524	CLIP-seq
MIRT1262250	hsa-miR-4530	CLIP-seq
MIRT1262251	hsa-miR-4532	CLIP-seq
MIRT1262252	hsa-miR-4651	CLIP-seq
MIRT1262253	hsa-miR-4653-3p	CLIP-seq
MIRT1262254	hsa-miR-4660	CLIP-seq
MIRT1262255	hsa-miR-4664-5p	CLIP-seq
MIRT1262256	hsa-miR-4692	CLIP-seq
MIRT1262257	hsa-miR-4706	CLIP-seq
MIRT1262258	hsa-miR-4719	CLIP-seq
MIRT1262259	hsa-miR-4728-5p	CLIP-seq
MIRT1262260	hsa-miR-4749-3p	CLIP-seq
MIRT1262261	hsa-miR-4749-5p	CLIP-seq
MIRT1262262	hsa-miR-4781-5p	CLIP-seq
MIRT1262263	hsa-miR-4796-3p	CLIP-seq
MIRT1262264	hsa-miR-497	CLIP-seq
MIRT1262265	hsa-miR-503	CLIP-seq
MIRT1262266	hsa-miR-516a-3p	CLIP-seq
MIRT1262267	hsa-miR-539	CLIP-seq
MIRT1262268	hsa-miR-607	CLIP-seq
MIRT1262269	hsa-miR-608	CLIP-seq
MIRT1262270	hsa-miR-612	CLIP-seq
MIRT1262271	hsa-miR-646	CLIP-seq
MIRT1262272	hsa-miR-1207-5p	CLIP-seq
MIRT1262273	hsa-miR-1231	CLIP-seq
MIRT1262274	hsa-miR-1271	CLIP-seq
MIRT1262222	hsa-miR-1305	CLIP-seq
MIRT1262275	hsa-miR-1321	CLIP-seq
MIRT1262276	hsa-miR-149	CLIP-seq
MIRT1262277	hsa-miR-1587	CLIP-seq
MIRT1262278	hsa-miR-182	CLIP-seq
MIRT1262226	hsa-miR-1915	CLIP-seq
MIRT1262279	hsa-miR-2110	CLIP-seq
MIRT1262280	hsa-miR-216b	CLIP-seq
MIRT1262281	hsa-miR-219-1-3p	CLIP-seq
MIRT1262282	hsa-miR-298	CLIP-seq
MIRT1262283	hsa-miR-3064-5p	CLIP-seq
MIRT1262284	hsa-miR-3119	CLIP-seq
MIRT1262285	hsa-miR-3125	CLIP-seq
MIRT1262286	hsa-miR-3151	CLIP-seq
MIRT1262287	hsa-miR-3159	CLIP-seq
MIRT1262288	hsa-miR-3165	CLIP-seq
MIRT1262289	hsa-miR-3173-3p	CLIP-seq
MIRT1262233	hsa-miR-3184	CLIP-seq
MIRT1262290	hsa-miR-330-3p	CLIP-seq
MIRT1262291	hsa-miR-3612	CLIP-seq
MIRT1262292	hsa-miR-3667-3p	CLIP-seq
MIRT1262236	hsa-miR-3671	CLIP-seq
MIRT1262293	hsa-miR-3916	CLIP-seq
MIRT1262239	hsa-miR-423-5p	CLIP-seq
MIRT1262294	hsa-miR-4270	CLIP-seq
MIRT1262295	hsa-miR-4271	CLIP-seq
MIRT1262296	hsa-miR-4288	CLIP-seq
MIRT1262242	hsa-miR-4307	CLIP-seq
MIRT1262297	hsa-miR-4417	CLIP-seq
MIRT1262298	hsa-miR-4419a	CLIP-seq
MIRT1262299	hsa-miR-4441	CLIP-seq
MIRT1262245	hsa-miR-4447	CLIP-seq
MIRT1262300	hsa-miR-4456	CLIP-seq
MIRT1262246	hsa-miR-4472	CLIP-seq
MIRT1262301	hsa-miR-4476	CLIP-seq
MIRT1262302	hsa-miR-4492	CLIP-seq
MIRT1262303	hsa-miR-4498	CLIP-seq
MIRT1262304	hsa-miR-4505	CLIP-seq
MIRT1262305	hsa-miR-4510	CLIP-seq
MIRT1262248	hsa-miR-4514	CLIP-seq
MIRT1262306	hsa-miR-4533	CLIP-seq
MIRT1262307	hsa-miR-4645-5p	CLIP-seq
MIRT1262252	hsa-miR-4651	CLIP-seq
MIRT1262308	hsa-miR-4656	CLIP-seq
MIRT1262309	hsa-miR-4673	CLIP-seq
MIRT1262310	hsa-miR-4675	CLIP-seq
MIRT1262311	hsa-miR-4688	CLIP-seq
MIRT1262256	hsa-miR-4692	CLIP-seq
MIRT1262258	hsa-miR-4719	CLIP-seq
MIRT1262312	hsa-miR-4725-3p	CLIP-seq
MIRT1262313	hsa-miR-4726-3p	CLIP-seq
MIRT1262259	hsa-miR-4728-5p	CLIP-seq
MIRT1262314	hsa-miR-4731-5p	CLIP-seq
MIRT1262315	hsa-miR-4736	CLIP-seq
MIRT1262316	hsa-miR-4739	CLIP-seq
MIRT1262317	hsa-miR-4741	CLIP-seq
MIRT1262318	hsa-miR-4756-5p	CLIP-seq
MIRT1262319	hsa-miR-4763-3p	CLIP-seq
MIRT1262320	hsa-miR-4779	CLIP-seq
MIRT1262321	hsa-miR-4794	CLIP-seq
MIRT1262322	hsa-miR-4795-5p	CLIP-seq
MIRT1262263	hsa-miR-4796-3p	CLIP-seq
MIRT1262323	hsa-miR-486-3p	CLIP-seq
MIRT1262324	hsa-miR-491-5p	CLIP-seq
MIRT1262267	hsa-miR-539	CLIP-seq
MIRT1262325	hsa-miR-548c-3p	CLIP-seq
MIRT1262326	hsa-miR-580	CLIP-seq
MIRT1262268	hsa-miR-607	CLIP-seq
MIRT1262269	hsa-miR-608	CLIP-seq
MIRT1262327	hsa-miR-632	CLIP-seq
MIRT1262328	hsa-miR-637	CLIP-seq
MIRT1262329	hsa-miR-650	CLIP-seq
MIRT1262330	hsa-miR-668	CLIP-seq
MIRT1262331	hsa-miR-762	CLIP-seq
MIRT1262332	hsa-miR-877	CLIP-seq
MIRT1262333	hsa-miR-9	CLIP-seq
MIRT1262334	hsa-miR-940	CLIP-seq
MIRT1262335	hsa-miR-96	CLIP-seq
MIRT1556845	hsa-miR-4723-5p	CLIP-seq
MIRT2077308	hsa-miR-1208	CLIP-seq
MIRT2077309	hsa-miR-1224-5p	CLIP-seq
MIRT2077310	hsa-miR-1246	CLIP-seq
MIRT2077311	hsa-miR-1290	CLIP-seq
MIRT2077312	hsa-miR-1304	CLIP-seq
MIRT2077313	hsa-miR-146a	CLIP-seq
MIRT2077314	hsa-miR-146b-5p	CLIP-seq
MIRT1262276	hsa-miR-149	CLIP-seq
MIRT1262277	hsa-miR-1587	CLIP-seq
MIRT1262226	hsa-miR-1915	CLIP-seq
MIRT1262280	hsa-miR-216b	CLIP-seq
MIRT2077315	hsa-miR-296-5p	CLIP-seq
MIRT1262283	hsa-miR-3064-5p	CLIP-seq
MIRT1262285	hsa-miR-3125	CLIP-seq
MIRT2077316	hsa-miR-3135b	CLIP-seq
MIRT2077317	hsa-miR-3148	CLIP-seq
MIRT2077318	hsa-miR-3150a-3p	CLIP-seq
MIRT2077319	hsa-miR-3157-3p	CLIP-seq
MIRT1262287	hsa-miR-3159	CLIP-seq
MIRT2077320	hsa-miR-3167	CLIP-seq
MIRT1262232	hsa-miR-3175	CLIP-seq
MIRT2077321	hsa-miR-3192	CLIP-seq
MIRT2077322	hsa-miR-335	CLIP-seq
MIRT2077323	hsa-miR-3662	CLIP-seq
MIRT1262292	hsa-miR-3667-3p	CLIP-seq
MIRT2077324	hsa-miR-3689a-3p	CLIP-seq
MIRT2077325	hsa-miR-3689c	CLIP-seq
MIRT2077326	hsa-miR-3915	CLIP-seq
MIRT1262293	hsa-miR-3916	CLIP-seq
MIRT2077327	hsa-miR-3928	CLIP-seq
MIRT2077328	hsa-miR-4251	CLIP-seq
MIRT2077329	hsa-miR-4259	CLIP-seq
MIRT2077330	hsa-miR-4260	CLIP-seq
MIRT2077331	hsa-miR-4283	CLIP-seq
MIRT1262242	hsa-miR-4307	CLIP-seq
MIRT2077332	hsa-miR-4324	CLIP-seq
MIRT1262244	hsa-miR-4424	CLIP-seq
MIRT1262245	hsa-miR-4447	CLIP-seq
MIRT1262300	hsa-miR-4456	CLIP-seq
MIRT1262246	hsa-miR-4472	CLIP-seq
MIRT1262301	hsa-miR-4476	CLIP-seq
MIRT2077333	hsa-miR-4489	CLIP-seq
MIRT1262302	hsa-miR-4492	CLIP-seq
MIRT1262303	hsa-miR-4498	CLIP-seq
MIRT1262248	hsa-miR-4514	CLIP-seq
MIRT2077334	hsa-miR-451b	CLIP-seq
MIRT1262251	hsa-miR-4532	CLIP-seq
MIRT1262306	hsa-miR-4533	CLIP-seq
MIRT1262307	hsa-miR-4645-5p	CLIP-seq
MIRT2077335	hsa-miR-4650-5p	CLIP-seq
MIRT1262252	hsa-miR-4651	CLIP-seq
MIRT1262253	hsa-miR-4653-3p	CLIP-seq
MIRT2077336	hsa-miR-4665-5p	CLIP-seq
MIRT1262309	hsa-miR-4673	CLIP-seq
MIRT2077337	hsa-miR-4674	CLIP-seq
MIRT2077338	hsa-miR-4689	CLIP-seq
MIRT1262256	hsa-miR-4692	CLIP-seq
MIRT2077339	hsa-miR-4694-3p	CLIP-seq
MIRT1262313	hsa-miR-4726-3p	CLIP-seq
MIRT1262259	hsa-miR-4728-5p	CLIP-seq
MIRT1262314	hsa-miR-4731-5p	CLIP-seq
MIRT1262260	hsa-miR-4749-3p	CLIP-seq
MIRT2077340	hsa-miR-4753-3p	CLIP-seq
MIRT2077341	hsa-miR-4758-3p	CLIP-seq
MIRT1262321	hsa-miR-4794	CLIP-seq
MIRT1262266	hsa-miR-516a-3p	CLIP-seq
MIRT2077342	hsa-miR-548u	CLIP-seq
MIRT2077343	hsa-miR-571	CLIP-seq
MIRT2077344	hsa-miR-579	CLIP-seq
MIRT2077345	hsa-miR-589	CLIP-seq
MIRT1262269	hsa-miR-608	CLIP-seq
MIRT2077346	hsa-miR-622	CLIP-seq
MIRT2077347	hsa-miR-625	CLIP-seq
MIRT2077348	hsa-miR-635	CLIP-seq
MIRT1262328	hsa-miR-637	CLIP-seq
MIRT1262331	hsa-miR-762	CLIP-seq
MIRT2077349	hsa-miR-874	CLIP-seq
MIRT2077350	hsa-miR-876-5p	CLIP-seq
MIRT1262332	hsa-miR-877	CLIP-seq
MIRT2077351	hsa-miR-938	CLIP-seq
MIRT1262334	hsa-miR-940	CLIP-seq
MIRT2077352	hsa-miR-942	CLIP-seq
MIRT2303762	hsa-miR-1207-3p	CLIP-seq
MIRT2077308	hsa-miR-1208	CLIP-seq
MIRT1262219	hsa-miR-1225-3p	CLIP-seq
MIRT1262220	hsa-miR-1233	CLIP-seq
MIRT2303763	hsa-miR-1262	CLIP-seq
MIRT2303764	hsa-miR-138	CLIP-seq
MIRT1262277	hsa-miR-1587	CLIP-seq
MIRT2303765	hsa-miR-2392	CLIP-seq
MIRT1262230	hsa-miR-3124-3p	CLIP-seq
MIRT1262285	hsa-miR-3125	CLIP-seq
MIRT2077316	hsa-miR-3135b	CLIP-seq
MIRT1262287	hsa-miR-3159	CLIP-seq
MIRT1262289	hsa-miR-3173-3p	CLIP-seq
MIRT1262233	hsa-miR-3184	CLIP-seq
MIRT2077321	hsa-miR-3192	CLIP-seq
MIRT2303766	hsa-miR-320e	CLIP-seq
MIRT2077322	hsa-miR-335	CLIP-seq
MIRT2303767	hsa-miR-3652	CLIP-seq
MIRT2077324	hsa-miR-3689a-3p	CLIP-seq
MIRT2077325	hsa-miR-3689c	CLIP-seq
MIRT1262293	hsa-miR-3916	CLIP-seq
MIRT1262239	hsa-miR-423-5p	CLIP-seq
MIRT2303768	hsa-miR-4286	CLIP-seq
MIRT2303769	hsa-miR-4290	CLIP-seq
MIRT1262298	hsa-miR-4419a	CLIP-seq
MIRT2303770	hsa-miR-4430	CLIP-seq
MIRT1262245	hsa-miR-4447	CLIP-seq
MIRT1262300	hsa-miR-4456	CLIP-seq
MIRT2303771	hsa-miR-4459	CLIP-seq
MIRT1262246	hsa-miR-4472	CLIP-seq
MIRT1262301	hsa-miR-4476	CLIP-seq
MIRT1262302	hsa-miR-4492	CLIP-seq
MIRT1262303	hsa-miR-4498	CLIP-seq
MIRT1262305	hsa-miR-4510	CLIP-seq
MIRT1262248	hsa-miR-4514	CLIP-seq
MIRT2303772	hsa-miR-4525	CLIP-seq
MIRT1262252	hsa-miR-4651	CLIP-seq
MIRT1262253	hsa-miR-4653-3p	CLIP-seq
MIRT2077336	hsa-miR-4665-5p	CLIP-seq
MIRT1262256	hsa-miR-4692	CLIP-seq
MIRT2303773	hsa-miR-4701-3p	CLIP-seq
MIRT2303774	hsa-miR-4716-3p	CLIP-seq
MIRT2303775	hsa-miR-4722-5p	CLIP-seq
MIRT1556845	hsa-miR-4723-5p	CLIP-seq
MIRT1262259	hsa-miR-4728-5p	CLIP-seq
MIRT1262314	hsa-miR-4731-5p	CLIP-seq
MIRT1262260	hsa-miR-4749-3p	CLIP-seq
MIRT1262320	hsa-miR-4779	CLIP-seq
MIRT1262263	hsa-miR-4796-3p	CLIP-seq
MIRT1262323	hsa-miR-486-3p	CLIP-seq
MIRT2303776	hsa-miR-512-5p	CLIP-seq
MIRT2303777	hsa-miR-541	CLIP-seq
MIRT2303778	hsa-miR-587	CLIP-seq
MIRT1262269	hsa-miR-608	CLIP-seq
MIRT2077347	hsa-miR-625	CLIP-seq
MIRT1262271	hsa-miR-646	CLIP-seq
MIRT2303779	hsa-miR-654-5p	CLIP-seq
MIRT2303780	hsa-miR-658	CLIP-seq
MIRT1262331	hsa-miR-762	CLIP-seq
MIRT2303781	hsa-miR-939	CLIP-seq
MIRT1262334	hsa-miR-940	CLIP-seq
MIRT2303762	hsa-miR-1207-3p	CLIP-seq
MIRT1262233	hsa-miR-3184	CLIP-seq
MIRT1262239	hsa-miR-423-5p	CLIP-seq
MIRT1262242	hsa-miR-4307	CLIP-seq
MIRT1262298	hsa-miR-4419a	CLIP-seq
MIRT1262305	hsa-miR-4510	CLIP-seq
MIRT1262260	hsa-miR-4749-3p	CLIP-seq
MIRT1262268	hsa-miR-607	CLIP-seq
MIRT1262271	hsa-miR-646	CLIP-seq
MIRT1262272	hsa-miR-1207-5p	CLIP-seq
MIRT1262273	hsa-miR-1231	CLIP-seq
MIRT2600659	hsa-miR-1267	CLIP-seq
MIRT1262274	hsa-miR-1271	CLIP-seq
MIRT1262276	hsa-miR-149	CLIP-seq
MIRT1262278	hsa-miR-182	CLIP-seq
MIRT1262226	hsa-miR-1915	CLIP-seq
MIRT1262279	hsa-miR-2110	CLIP-seq
MIRT1262280	hsa-miR-216b	CLIP-seq
MIRT1262283	hsa-miR-3064-5p	CLIP-seq
MIRT1262284	hsa-miR-3119	CLIP-seq
MIRT2600660	hsa-miR-3147	CLIP-seq
MIRT2077317	hsa-miR-3148	CLIP-seq
MIRT2077318	hsa-miR-3150a-3p	CLIP-seq
MIRT1262287	hsa-miR-3159	CLIP-seq
MIRT1262233	hsa-miR-3184	CLIP-seq
MIRT2600661	hsa-miR-3188	CLIP-seq
MIRT1262290	hsa-miR-330-3p	CLIP-seq
MIRT1262292	hsa-miR-3667-3p	CLIP-seq
MIRT1262239	hsa-miR-423-5p	CLIP-seq
MIRT1262294	hsa-miR-4270	CLIP-seq
MIRT1262295	hsa-miR-4271	CLIP-seq
MIRT1262296	hsa-miR-4288	CLIP-seq
MIRT2600662	hsa-miR-4311	CLIP-seq
MIRT2600663	hsa-miR-4425	CLIP-seq
MIRT1262299	hsa-miR-4441	CLIP-seq
MIRT1262301	hsa-miR-4476	CLIP-seq
MIRT2600664	hsa-miR-4509	CLIP-seq
MIRT1262248	hsa-miR-4514	CLIP-seq
MIRT1262307	hsa-miR-4645-5p	CLIP-seq
MIRT2600665	hsa-miR-4668-5p	CLIP-seq
MIRT1262309	hsa-miR-4673	CLIP-seq
MIRT1262311	hsa-miR-4688	CLIP-seq
MIRT1262256	hsa-miR-4692	CLIP-seq
MIRT1262312	hsa-miR-4725-3p	CLIP-seq
MIRT1262313	hsa-miR-4726-3p	CLIP-seq
MIRT1262315	hsa-miR-4736	CLIP-seq
MIRT1262319	hsa-miR-4763-3p	CLIP-seq
MIRT1262321	hsa-miR-4794	CLIP-seq
MIRT1262323	hsa-miR-486-3p	CLIP-seq
MIRT1262266	hsa-miR-516a-3p	CLIP-seq
MIRT1262325	hsa-miR-548c-3p	CLIP-seq
MIRT1262268	hsa-miR-607	CLIP-seq
MIRT1262327	hsa-miR-632	CLIP-seq
MIRT2303780	hsa-miR-658	CLIP-seq
MIRT1262330	hsa-miR-668	CLIP-seq
MIRT1262333	hsa-miR-9	CLIP-seq
MIRT1262334	hsa-miR-940	CLIP-seq
MIRT1262335	hsa-miR-96	CLIP-seq
MIRT1262272	hsa-miR-1207-5p	CLIP-seq
MIRT1262273	hsa-miR-1231	CLIP-seq
MIRT2600659	hsa-miR-1267	CLIP-seq
MIRT1262274	hsa-miR-1271	CLIP-seq
MIRT1262276	hsa-miR-149	CLIP-seq
MIRT1262278	hsa-miR-182	CLIP-seq
MIRT1262226	hsa-miR-1915	CLIP-seq
MIRT1262279	hsa-miR-2110	CLIP-seq
MIRT1262280	hsa-miR-216b	CLIP-seq
MIRT1262283	hsa-miR-3064-5p	CLIP-seq
MIRT1262284	hsa-miR-3119	CLIP-seq
MIRT2600660	hsa-miR-3147	CLIP-seq
MIRT2077317	hsa-miR-3148	CLIP-seq
MIRT2077318	hsa-miR-3150a-3p	CLIP-seq
MIRT1262287	hsa-miR-3159	CLIP-seq
MIRT1262233	hsa-miR-3184	CLIP-seq
MIRT2600661	hsa-miR-3188	CLIP-seq
MIRT1262290	hsa-miR-330-3p	CLIP-seq
MIRT1262292	hsa-miR-3667-3p	CLIP-seq
MIRT1262239	hsa-miR-423-5p	CLIP-seq
MIRT1262294	hsa-miR-4270	CLIP-seq
MIRT1262295	hsa-miR-4271	CLIP-seq
MIRT1262296	hsa-miR-4288	CLIP-seq
MIRT2600662	hsa-miR-4311	CLIP-seq
MIRT2600663	hsa-miR-4425	CLIP-seq
MIRT1262299	hsa-miR-4441	CLIP-seq
MIRT1262248	hsa-miR-4514	CLIP-seq
MIRT1262307	hsa-miR-4645-5p	CLIP-seq
MIRT2600665	hsa-miR-4668-5p	CLIP-seq
MIRT1262309	hsa-miR-4673	CLIP-seq
MIRT1262311	hsa-miR-4688	CLIP-seq
MIRT1262256	hsa-miR-4692	CLIP-seq
MIRT1262312	hsa-miR-4725-3p	CLIP-seq
MIRT1262313	hsa-miR-4726-3p	CLIP-seq
MIRT1262315	hsa-miR-4736	CLIP-seq
MIRT1262319	hsa-miR-4763-3p	CLIP-seq
MIRT1262321	hsa-miR-4794	CLIP-seq
MIRT1262323	hsa-miR-486-3p	CLIP-seq
MIRT1262266	hsa-miR-516a-3p	CLIP-seq
MIRT1262325	hsa-miR-548c-3p	CLIP-seq
MIRT1262268	hsa-miR-607	CLIP-seq
MIRT1262327	hsa-miR-632	CLIP-seq
MIRT2303780	hsa-miR-658	CLIP-seq
MIRT1262330	hsa-miR-668	CLIP-seq
MIRT1262333	hsa-miR-9	CLIP-seq
MIRT1262334	hsa-miR-940	CLIP-seq
MIRT1262335	hsa-miR-96	CLIP-seq

Show/Hide all(84)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000086	Process	G2/M transition of mitotic cell cycle	TAS
GO:0000287	Function	Magnesium ion binding	IEA
GO:0001669	Component	Acrosomal vesicle	ISS
GO:0001707	Process	Mesoderm formation	IEA
GO:0001843	Process	Neural tube closure	IEA
GO:0002027	Process	Regulation of heart rate	TAS	23507255
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0003091	Process	Renal water homeostasis	TAS
GO:0004672	Function	Protein kinase activity	IDA	12475942
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	21085490
GO:0004674	Function	Protein serine/threonine kinase activity	IMP	26537248
GO:0004679	Function	AMP-activated protein kinase activity	IEA
GO:0004691	Function	CAMP-dependent protein kinase activity	IDA	11029056
GO:0004691	Function	CAMP-dependent protein kinase activity	ISS
GO:0004691	Function	CAMP-dependent protein kinase activity	NAS	2843813
GO:0004691	Function	CAMP-dependent protein kinase activity	TAS
GO:0004712	Function	Protein serine/threonine/tyrosine kinase activity	IDA	22797923
GO:0005515	Function	Protein binding	IPI	11035810, 12475942, 15630084, 15655353, 16387847, 17148597, 17911601, 18836454, 21085490, 23455922, 23602568, 24351927, 24464040, 24605759, 24700472, 24855271, 24860872, 25477193, 26496610, 27107012, 29568061, 31980649, 32296183, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	21085490
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	21085490
GO:0005739	Component	Mitochondrion	IEA
GO:0005813	Component	Centrosome	IDA	21399614
GO:0005829	Component	Cytosol	TAS
GO:0005930	Component	Axoneme	IDA	12475942
GO:0005952	Component	CAMP-dependent protein kinase complex	IDA	12475942
GO:0005952	Component	CAMP-dependent protein kinase complex	NAS	2843813
GO:0006397	Process	MRNA processing	IDA	17594903
GO:0006468	Process	Protein phosphorylation	IDA	12475942
GO:0006468	Process	Protein phosphorylation	NAS	2843813
GO:0007596	Process	Blood coagulation	TAS
GO:0010389	Process	Regulation of G2/M transition of mitotic cell cycle	TAS
GO:0010737	Process	Protein kinase A signaling	IBA	21873635
GO:0010881	Process	Regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion	TAS	23507255
GO:0016020	Component	Membrane	IDA	15569306
GO:0016241	Process	Regulation of macroautophagy	TAS	26046386
GO:0016607	Component	Nuclear speck	IDA	17594903
GO:0018105	Process	Peptidyl-serine phosphorylation	IDA	10805756, 11029056
GO:0018105	Process	Peptidyl-serine phosphorylation	IMP	26537248
GO:0018105	Process	Peptidyl-serine phosphorylation	TAS	26078884
GO:0018107	Process	Peptidyl-threonine phosphorylation	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019901	Function	Protein kinase binding	IPI	11035810, 17911601
GO:0019904	Function	Protein domain specific binding	IEA
GO:0030145	Function	Manganese ion binding	IEA
GO:0031594	Component	Neuromuscular junction	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IDA	21423175
GO:0034199	Process	Activation of protein kinase A activity	TAS
GO:0034237	Function	Protein kinase A regulatory subunit binding	IBA	21873635
GO:0034237	Function	Protein kinase A regulatory subunit binding	IPI	17911601
GO:0034380	Process	High-density lipoprotein particle assembly	TAS
GO:0034605	Process	Cellular response to heat	IDA	21085490
GO:0034704	Component	Calcium channel complex	TAS	23507255
GO:0035584	Process	Calcium-mediated signaling using intracellular calcium source	TAS	23507255
GO:0036126	Component	Sperm flagellum	IEA
GO:0043197	Component	Dendritic spine	IEA
GO:0043393	Process	Regulation of protein binding	TAS	23507255
GO:0044853	Component	Plasma membrane raft	IDA	17911601
GO:0045667	Process	Regulation of osteoblast differentiation	IDA	19949837
GO:0046777	Process	Protein autophosphorylation	IEA
GO:0046827	Process	Positive regulation of protein export from nucleus	IEA
GO:0048240	Process	Sperm capacitation	ISS
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	21085490
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	TAS	23507255
GO:0055117	Process	Regulation of cardiac muscle contraction	TAS	23507255
GO:0060314	Process	Regulation of ryanodine-sensitive calcium-release channel activity	TAS	23507255
GO:0061136	Process	Regulation of proteasomal protein catabolic process	IDA	17565987
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070613	Process	Regulation of protein processing	IEA
GO:0071158	Process	Positive regulation of cell cycle arrest	ISS
GO:0071333	Process	Cellular response to glucose stimulus	IDA	19949837
GO:0071374	Process	Cellular response to parathyroid hormone stimulus	IEA
GO:0071377	Process	Cellular response to glucagon stimulus	TAS
GO:0071872	Process	Cellular response to epinephrine stimulus	TAS	23507255
GO:0086064	Process	Cell communication by electrical coupling involved in cardiac conduction	TAS	23507255
GO:0097546	Component	Ciliary base	TAS
GO:0097711	Process	Ciliary basal body-plasma membrane docking	TAS
GO:1901621	Process	Negative regulation of smoothened signaling pathway involved in dorsal/ventral neural tube patterning	IEA
GO:1903779	Process	Regulation of cardiac conduction	TAS
GO:2000810	Process	Regulation of bicellular tight junction assembly	IDA	15905176

MIM	HGNC	e!Ensembl
601639	9380	ENSG00000072062

Protein

UniProt ID

P17612

Protein name

cAMP-dependent protein kinase catalytic subunit alpha (PKA C-alpha) (EC 2.7.11.11)

Protein function

Phosphorylates a large number of substrates in the cytoplasm and the nucleus (PubMed:15642694, PubMed:15905176, PubMed:16387847, PubMed:17333334, PubMed:17565987, PubMed:17693412, PubMed:18836454, PubMed:19949837, PubMed:20356841, PubMed:2108549

PDB

2GU8 , 3AGL , 3AGM , 3AMA , 3AMB , 3L9L , 3L9M , 3L9N , 3MVJ , 3NX8 , 3OOG , 3OVV , 3OWP , 3OXT , 3P0M , 3POO , 3VQH , 4AE6 , 4AE9 , 4UJ1 , 4UJ2 , 4UJ9 , 4UJA , 4UJB , 4WB5 , 4WB6 , 4WB7 , 4WB8 , 5BX6 , 5BX7 , 5IZF , 5IZJ , 5J5X , 5N23 , 5UZK , 6BYR , 6BYS , 6C0U , 6FRX , 6NO7 , 6QJ7 , 6WJF , 6WJG , 7Y1G , 8FE2 , 8FE5 , 8FEC , 8X5L

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	44 → 298	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 1 is ubiquitous. Isoform 2 is sperm-specific and is enriched in pachytene spermatocytes but is not detected in round spermatids. {ECO:0000269|PubMed:10906071, ECO:0000269|PubMed:21812984}.

Sequence

MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVML
VKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF

Sequence length

351

Interactions

View interactions

	KEGG		Reactome
	Endocrine resistance MAPK signaling pathway Ras signaling pathway Calcium signaling pathway cAMP signaling pathway Chemokine signaling pathway Hormone signaling Oocyte meiosis Autophagy - animal Longevity regulating pathway Longevity regulating pathway - multiple species Adrenergic signaling in cardiomyocytes Vascular smooth muscle contraction Wnt signaling pathway Hedgehog signaling pathway Apelin signaling pathway Tight junction Gap junction Platelet activation Circadian entrainment Thermogenesis Long-term potentiation Retrograde endocannabinoid signaling Glutamatergic synapse Cholinergic synapse Serotonergic synapse GABAergic synapse Dopaminergic synapse Olfactory transduction Taste transduction Inflammatory mediator regulation of TRP channels Insulin signaling pathway Insulin secretion GnRH signaling pathway Ovarian steroidogenesis Progesterone-mediated oocyte maturation Estrogen signaling pathway Melanogenesis Thyroid hormone synthesis Thyroid hormone signaling pathway Oxytocin signaling pathway Glucagon signaling pathway Regulation of lipolysis in adipocytes Renin secretion Aldosterone synthesis and secretion Relaxin signaling pathway Cortisol synthesis and secretion Parathyroid hormone synthesis, secretion and action Cushing syndrome Growth hormone synthesis, secretion and action Endocrine and other factor-regulated calcium reabsorption Vasopressin-regulated water reabsorption Salivary secretion Gastric acid secretion Bile secretion Parkinson disease Prion disease Cocaine addiction Amphetamine addiction Morphine addiction Alcoholism Vibrio cholerae infection Amoebiasis Human cytomegalovirus infection Human papillomavirus infection Human T-cell leukemia virus 1 infection Pathways in cancer Viral carcinogenesis Proteoglycans in cancer Chemical carcinogenesis - receptor activation Dilated cardiomyopathy		PKA activation PKA activation in glucagon signalling DARPP-32 events Regulation of PLK1 Activity at G2/M Transition Loss of Nlp from mitotic centrosomes Recruitment of mitotic centrosome proteins and complexes Loss of proteins required for interphase microtubule organization from the centrosome Recruitment of NuMA to mitotic centrosomes Glucagon-like Peptide-1 (GLP1) regulates insulin secretion Rap1 signalling Regulation of insulin secretion Vasopressin regulates renal water homeostasis via Aquaporins VEGFA-VEGFR2 Pathway CREB1 phosphorylation through the activation of Adenylate Cyclase Interleukin-3, Interleukin-5 and GM-CSF signaling Ion homeostasis GLI3 is processed to GLI3R by the proteasome Hedgehog 'off' state Anchoring of the basal body to the plasma membrane CD209 (DC-SIGN) signaling MAPK6/MAPK4 signaling RET signaling AURKA Activation by TPX2 HDL assembly ADORA2B mediated anti-inflammatory cytokines production FCGR3A-mediated IL10 synthesis Factors involved in megakaryocyte development and platelet production

Show/Hide Causal Diseases (7)

Disease term	Disease name	dbSNP ID	References
Causal
Congenital adrenal hyperplasia	Congenital adrenal hyperplasia	rs104894069, rs1365173817, rs104894070, rs556794126, rs104894138, rs104894139, rs104894149, rs104894142, rs104894153, rs6471, rs7769409, rs9378251, rs201552310, rs397509367, rs6445 View all (55 more)
Diabetes mellitus	Diabetes Mellitus	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237 View all (293 more)
Hepatocellular carcinoma	Fibrolamellar Hepatocellular Carcinoma, Fibrolamellar hepatocellular carcinoma	rs397514032, rs587776627, rs587776665, rs28934571, rs121912654, rs121913279, rs587776802, rs121913274, rs121913675, rs121913676, rs121913677, rs78014899, rs121434587, rs121434588, rs121913407 View all (7 more)	24578576
Hypertension	Hypertensive disease	rs13306026
Myopathy	Myopathy	rs137854521, rs386834236, rs121908557, rs121909092, rs111033570, rs104894299, rs104894294, rs121909273, rs121909274, rs121909275, rs199474699, rs199476140, rs118192165, rs118192169, rs118192166 View all (81 more)
Osteoporosis	Osteoporosis	rs72658152, rs72667023, rs587776916, rs72656370, rs768615287
Pigmented nodular adrenocortical disease	PIGMENTED NODULAR ADRENOCORTICAL DISEASE, PRIMARY, 4, Primary pigmented nodular adrenocortical disease	rs121918360, rs281864801, rs386352352, rs724160013, rs769235876, rs771254375	24747643, 24855271, 24700472, 24571724

Show/Hide Unknown Diseases (4)

Disease term	Disease name	References	Source
Unknown
Cholangiocarcinoma	Cholangiocarcinoma, Extrahepatic Cholangiocarcinoma	26258846	ClinVar
Mental depression	Depressive disorder		ClinVar
Pigmented Nodular Adrenocortical Disease	pigmented nodular adrenocortical disease, primary, 4		GenCC
Ellis-Van Creveld Syndrome	Ellis-van Creveld syndrome		GenCC

Show/Hide Text Mining Associations (44)

Disease Name	Relationship Type	References
Associations from Text Mining
ACTH Secreting Pituitary Adenoma	Associate	25069672, 26701869, 28894201, 34520814, 34534321, 34852451, 35216289, 35675123
Adenocarcinoma	Associate	35322195
Adenoma	Associate	24571724, 25449630, 34852451
Adrenal Cortex Neoplasms	Associate	25449630
Adrenal Gland Neoplasms	Associate	24747643, 32895490
Adrenocortical Adenoma	Associate	24571724, 25069672, 26701869, 26743443, 27165862, 27606678, 31489371, 34224748, 35399924
Adrenocortical Carcinoma	Associate	32875319
Angina Stable	Associate	32154962
Aphakia congenital primary	Associate	25069672
Bile Duct Diseases	Associate	31678302
Breast Neoplasms	Associate	24909179, 33910530
Carcinoma Hepatocellular	Associate	27029710, 31862487, 37119001, 37596321
Cardiomyopathies	Associate	37852321
Cardiomyopathy infantile histiocytoid	Associate	37871652
Carney Complex	Associate	29222914
Ciliopathies	Associate	33875766
Cleft Palate	Associate	32875319
Colorectal Neoplasms	Associate	35836259
Cushing Syndrome	Associate	24571724, 24747643, 25069672, 25449630, 25924874, 27165862, 31489371, 34224748, 34520814, 34534321, 35216289, 37306403
Death	Associate	19573263
Depressive Disorder Major	Associate	19573263
Diabetes Mellitus Type 1	Associate	33827531
Fibrolamellar hepatocellular carcinoma	Associate	24578576, 25605237, 25698061, 26489647, 27015136, 27029710, 28304380, 28862261, 29222914, 29335433, 31676785, 31862487, 32154962, 32663328, 34436901 View all (5 more)
Focal Nodular Hyperplasia	Associate	25924874
Genetic Diseases Inborn	Associate	25924874
Glioma	Inhibit	33885249
Glomerulonephritis IGA	Associate	30029622
Hamartoma Syndrome Multiple	Associate	32875319
Hyperaldosteronism	Associate	25069672
Hyperlipidemias	Inhibit	22819546
Hyperplasia	Associate	24571724, 25449630, 25924874
Inflammation	Associate	25557953, 35735057
Myocardial Infarction	Associate	35432334
Neoplasm Invasiveness	Associate	31678302
Neoplasms	Associate	24578576, 24747643, 25557953, 26202601, 27165862, 28405879, 31676785, 31862487, 32895490, 35322195, 36302754
Neoplasms	Stimulate	37871652
Neural Tube Defects	Associate	16080189
Pancreatic Cyst	Associate	31678302
Pancreatic Intraductal Neoplasms	Associate	31678302, 37871652
Pancreatic Neoplasms	Associate	31676785, 31678302
Pigmented Nodular Adrenocortical Disease Primary 1	Associate	28834963
Pigmented Nodular Adrenocortical Disease Primary 2	Associate	25449630
Primary cortisol resistance	Associate	34534321
Testicular Germ Cell Tumor	Associate	39258697

PRKACA (protein kinase cAMP-activated catalytic subunit alpha)