Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
55658
Gene name Gene Name - the full gene name approved by the HGNC.
Ring finger protein 126
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RNF126
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. [provided by RefSeq, Jul 2008]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT037228 hsa-miR-877-5p CLASH 23622248
MIRT469140 hsa-miR-4524b-3p PAR-CLIP 23592263
MIRT469139 hsa-miR-6873-5p PAR-CLIP 23592263
MIRT469138 hsa-miR-6847-5p PAR-CLIP 23592263
MIRT469137 hsa-miR-6777-5p PAR-CLIP 23592263
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005154 Function Epidermal growth factor receptor binding IEA
GO:0005515 Function Protein binding IPI 14667819, 16189514, 19549727, 23026136, 23277564, 24981174, 25416956, 26496610, 28514442, 31515488, 32814053
GO:0005634 Component Nucleus IDA 23026136
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IDA 23026136
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
615177 21151 ENSG00000070423
Protein
UniProt ID Q9BV68
Protein name E3 ubiquitin-protein ligase RNF126 (EC 2.3.2.27) (RING finger protein 126)
Protein function E3 ubiquitin-protein ligase that mediates ubiquitination oF target proteins (PubMed:23277564, PubMed:24275455, PubMed:24981174, PubMed:36563124). Depending on the associated E2 ligase, mediates 'Lys-27'-, 'Lys-29'-, 'Lys-48'- and/or 'Lys-63'-lin
PDB 2N9O , 2N9P
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14369 zinc_ribbon_9 9 40 zinc-ribbon Domain
PF13639 zf-RING_2 227 270 Ring finger domain Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in liver and testis. {ECO:0000269|PubMed:23026136}.
Sequence
MAEASPHPGRYFCHCCSVEIVPRLPDYICPRCESGFIEELPEETRSTENGSAPSTAPTDQ
SRPPLEHVDQHLFTLPQGYGQFAFGIFDDSFEIPTFPPGAQADDGRDPESRRERDHPSRH
RYGARQPRARLTTRRATGRHEGVPTLEGIIQQLVNGIITPATIPSLGPWGVLHSNPMDYA
WGANGLDAIITQLLNQFENTGPPPADKEKIQALPTVPVTEEHVGSGLECPVCKDDYALGE
RVRQLPCNHLFHDGCIVPWLEQHDSCPVCR
KSLTGQNTATNPPGLTGVSFSSSSSSSSSS
SPSNENATSNS
Sequence length 311
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Antigen processing: Ubiquitination & Proteasome degradation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Leukemia Leukemia, Myelocytic, Acute rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297 27903959
Unknown
Disease term Disease name Evidence References Source
Prostate cancer Prostate cancer Together, these results show that PRRX2 is an oncogene and might play a role in the aggressiveness of PC within the DNPC population. GWAS, CBGDA
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 29326282, 36539893
Calcinosis Cutis Associate 36539893
Carcinogenesis Associate 26234677
Carcinoma Ovarian Epithelial Stimulate 32254065
Friedreich Ataxia Associate 28228265
Neoplasm Metastasis Associate 32254065
Neoplasms Associate 26234677, 29326282