Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55658
Gene name	Ring finger protein 126
Gene symbol	RNF126
Synonyms (NCBI Gene)	-
Chromosome	19
Chromosome location	19p13.3
Summary	The protein encoded by this gene contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. [provided by RefSeq, Jul 2008]

Show/Hide all (92)

miRTarBase ID	miRNA	Experiments	Reference
MIRT037228	hsa-miR-877-5p	CLASH	23622248
MIRT469140	hsa-miR-4524b-3p	PAR-CLIP	23592263
MIRT469139	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT469138	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT469137	hsa-miR-6777-5p	PAR-CLIP	23592263
MIRT469136	hsa-miR-6889-5p	PAR-CLIP	23592263
MIRT469135	hsa-miR-485-5p	PAR-CLIP	23592263
MIRT469134	hsa-miR-6884-5p	PAR-CLIP	23592263
MIRT469133	hsa-miR-6804-5p	PAR-CLIP	23592263
MIRT469132	hsa-miR-655-5p	PAR-CLIP	23592263
MIRT469131	hsa-miR-377-5p	PAR-CLIP	23592263
MIRT469130	hsa-miR-6086	PAR-CLIP	23592263
MIRT469129	hsa-miR-4731-5p	PAR-CLIP	23592263
MIRT469128	hsa-miR-4505	PAR-CLIP	23592263
MIRT469127	hsa-miR-5787	PAR-CLIP	23592263
MIRT469126	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT469125	hsa-miR-4710	PAR-CLIP	23592263
MIRT469124	hsa-miR-1294	PAR-CLIP	23592263
MIRT037228	hsa-miR-877-5p	PAR-CLIP	23592263
MIRT469123	hsa-miR-6866-5p	PAR-CLIP	23592263
MIRT469122	hsa-miR-1303	PAR-CLIP	23592263
MIRT469124	hsa-miR-1294	PAR-CLIP	27292025
MIRT469122	hsa-miR-1303	PAR-CLIP	27292025
MIRT469131	hsa-miR-377-5p	PAR-CLIP	27292025
MIRT469128	hsa-miR-4505	PAR-CLIP	27292025
MIRT469140	hsa-miR-4524b-3p	PAR-CLIP	27292025
MIRT469125	hsa-miR-4710	PAR-CLIP	27292025
MIRT469129	hsa-miR-4731-5p	PAR-CLIP	27292025
MIRT469135	hsa-miR-485-5p	PAR-CLIP	27292025
MIRT469127	hsa-miR-5787	PAR-CLIP	27292025
MIRT469130	hsa-miR-6086	PAR-CLIP	27292025
MIRT469132	hsa-miR-655-5p	PAR-CLIP	27292025
MIRT469137	hsa-miR-6777-5p	PAR-CLIP	27292025
MIRT469133	hsa-miR-6804-5p	PAR-CLIP	27292025
MIRT469126	hsa-miR-6825-5p	PAR-CLIP	27292025
MIRT469138	hsa-miR-6847-5p	PAR-CLIP	27292025
MIRT469123	hsa-miR-6866-5p	PAR-CLIP	27292025
MIRT469139	hsa-miR-6873-5p	PAR-CLIP	27292025
MIRT469134	hsa-miR-6884-5p	PAR-CLIP	27292025
MIRT469136	hsa-miR-6889-5p	PAR-CLIP	27292025
MIRT037228	hsa-miR-877-5p	PAR-CLIP	27292025
MIRT469140	hsa-miR-4524b-3p	PAR-CLIP	23592263
MIRT469139	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT469138	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT469137	hsa-miR-6777-5p	PAR-CLIP	23592263
MIRT469136	hsa-miR-6889-5p	PAR-CLIP	23592263
MIRT469135	hsa-miR-485-5p	PAR-CLIP	23592263
MIRT469134	hsa-miR-6884-5p	PAR-CLIP	23592263
MIRT469133	hsa-miR-6804-5p	PAR-CLIP	23592263
MIRT469132	hsa-miR-655-5p	PAR-CLIP	23592263
MIRT469131	hsa-miR-377-5p	PAR-CLIP	23592263
MIRT469130	hsa-miR-6086	PAR-CLIP	23592263
MIRT469129	hsa-miR-4731-5p	PAR-CLIP	23592263
MIRT469128	hsa-miR-4505	PAR-CLIP	23592263
MIRT469127	hsa-miR-5787	PAR-CLIP	23592263
MIRT469126	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT469125	hsa-miR-4710	PAR-CLIP	23592263
MIRT469124	hsa-miR-1294	PAR-CLIP	23592263
MIRT037228	hsa-miR-877-5p	PAR-CLIP	23592263
MIRT469123	hsa-miR-6866-5p	PAR-CLIP	23592263
MIRT469122	hsa-miR-1303	PAR-CLIP	23592263
MIRT1309897	hsa-miR-142-3p	CLIP-seq
MIRT1309898	hsa-miR-3130-5p	CLIP-seq
MIRT1309899	hsa-miR-4280	CLIP-seq
MIRT1309900	hsa-miR-4482	CLIP-seq
MIRT1309901	hsa-miR-4753-3p	CLIP-seq
MIRT1309902	hsa-miR-562	CLIP-seq
MIRT1309903	hsa-miR-622	CLIP-seq
MIRT2092053	hsa-miR-1184	CLIP-seq
MIRT2092054	hsa-miR-3121-3p	CLIP-seq
MIRT2092055	hsa-miR-3649	CLIP-seq
MIRT2092056	hsa-miR-492	CLIP-seq
MIRT2092057	hsa-miR-498	CLIP-seq
MIRT2316531	hsa-miR-1275	CLIP-seq
MIRT2316532	hsa-miR-296-5p	CLIP-seq
MIRT2316533	hsa-miR-4525	CLIP-seq
MIRT2316534	hsa-miR-4665-5p	CLIP-seq
MIRT2316535	hsa-miR-4723-5p	CLIP-seq
MIRT2316536	hsa-miR-625	CLIP-seq
MIRT2316537	hsa-miR-939	CLIP-seq
MIRT2612571	hsa-miR-146b-3p	CLIP-seq
MIRT2612572	hsa-miR-3173-5p	CLIP-seq
MIRT2612573	hsa-miR-3937	CLIP-seq
MIRT2612574	hsa-miR-4308	CLIP-seq
MIRT2612575	hsa-miR-4722-3p	CLIP-seq
MIRT2612576	hsa-miR-874	CLIP-seq
MIRT2612571	hsa-miR-146b-3p	CLIP-seq
MIRT2612572	hsa-miR-3173-5p	CLIP-seq
MIRT2612573	hsa-miR-3937	CLIP-seq
MIRT2612574	hsa-miR-4308	CLIP-seq
MIRT2612575	hsa-miR-4722-3p	CLIP-seq
MIRT2612576	hsa-miR-874	CLIP-seq

Show/Hide all (36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000209	Process	Protein polyubiquitination	IEA
GO:0000724	Process	Double-strand break repair via homologous recombination	IDA	29670289, 30612738
GO:0005154	Function	Epidermal growth factor receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	14667819, 16189514, 19549727, 23026136, 23277564, 24981174, 25416956, 26496610, 28514442, 31515488, 32814053, 33961781, 35271311
GO:0005634	Component	Nucleus	IDA	23026136
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	23026136
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	24981174
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IMP	23026136
GO:0006513	Process	Protein monoubiquitination	IDA	23277564
GO:0008270	Function	Zinc ion binding	IEA
GO:0016567	Process	Protein ubiquitination	IBA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0035519	Process	Protein K29-linked ubiquitination	IDA	36563124
GO:0042059	Process	Negative regulation of epidermal growth factor receptor signaling pathway	IMP	23418353
GO:0042127	Process	Regulation of cell population proliferation	IMP	23026136
GO:0042147	Process	Retrograde transport, endosome to Golgi	IMP	24275455
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	24981174
GO:0043162	Process	Ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway	IMP	23418353
GO:0044314	Process	Protein K27-linked ubiquitination	IDA	36563124
GO:0046872	Function	Metal ion binding	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	23026136, 24981174, 36563124
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0070534	Process	Protein K63-linked ubiquitination	IEA
GO:0070534	Process	Protein K63-linked ubiquitination	ISS
GO:0070936	Process	Protein K48-linked ubiquitination	IEA
GO:0070936	Process	Protein K48-linked ubiquitination	ISS
GO:0071629	Process	Cytoplasm protein quality control by the ubiquitin-proteasome system	IMP	24981174
GO:0110025	Process	DNA strand resection involved in replication fork processing	IMP	26240375
GO:1905168	Process	Positive regulation of double-strand break repair via homologous recombination	IDA	36563124

MIM	HGNC	e!Ensembl
615177	21151	ENSG00000070423

Q9BV68

Protein name

E3 ubiquitin-protein ligase RNF126 (EC 2.3.2.27) (RING finger protein 126)

Protein function

E3 ubiquitin-protein ligase that mediates ubiquitination oF target proteins (PubMed:23277564, PubMed:24275455, PubMed:24981174, PubMed:36563124). Depending on the associated E2 ligase, mediates 'Lys-27'-, 'Lys-29'-, 'Lys-48'- and/or 'Lys-63'-lin

PDB

2N9O , 2N9P

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14369	zinc_ribbon_9	9 → 40	zinc-ribbon	Domain
PF13639	zf-RING_2	227 → 270	Ring finger domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in liver and testis. {ECO:0000269|PubMed:23026136}.

Sequence

MAEASPHPGRYFCHCCSVEIVPRLPDYICPRCESGFIEELPEETRSTENGSAPSTAPTDQ
SRPPLEHVDQHLFTLPQGYGQFAFGIFDDSFEIPTFPPGAQADDGRDPESRRERDHPSRH
RYGARQPRARLTTRRATGRHEGVPTLEGIIQQLVNGIITPATIPSLGPWGVLHSNPMDYA
WGANGLDAIITQLLNQFENTGPPPADKEKIQALPTVPVTEEHVGSGLECPVCKDDYALGE
RVRQLPCNHLFHDGCIVPWLEQHDSCPVCRKSLTGQNTATNPPGLTGVSFSSSSSSSSSS
SPSNENATSNS

Sequence length

311

Interactions

View interactions

	Reactome
			Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	29326282, 36539893	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis Cutis	Associate	36539893	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	26234677	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Stimulate	32254065	★★★★★ ★☆☆☆☆ Found in Text Mining only
Friedreich Ataxia	Associate	28228265	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	32254065	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	26234677, 29326282	★★★★★ ★☆☆☆☆ Found in Text Mining only

RNF126 (ring finger protein 126)