Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55559
Gene name	HAUS augmin like complex subunit 7
Gene symbol	HAUS7
Synonyms (NCBI Gene)	UCHL5IPUIP1
Chromosome	X
Chromosome location	Xq28
Summary	This gene encodes a subunit of the augmin complex, which regulates centrosome and mitotic spindle integrity, and is necessary for the completion of cytokinesis. The encoded protein was identified by interaction with ubiquitin C-terminal hydrolase 37. Alte

Show/Hide all (16)

miRTarBase ID	miRNA	Experiments
MIRT1041381	hsa-miR-3151	CLIP-seq
MIRT1041382	hsa-miR-337-5p	CLIP-seq
MIRT1041383	hsa-miR-4283	CLIP-seq
MIRT1041384	hsa-miR-4489	CLIP-seq
MIRT1041385	hsa-miR-4772-3p	CLIP-seq
MIRT1041386	hsa-miR-891a	CLIP-seq
MIRT2544649	hsa-miR-3064-3p	CLIP-seq
MIRT2544650	hsa-miR-3074-5p	CLIP-seq
MIRT2544651	hsa-miR-3158-3p	CLIP-seq
MIRT2544652	hsa-miR-3689a-3p	CLIP-seq
MIRT2544653	hsa-miR-3689c	CLIP-seq
MIRT2544654	hsa-miR-4707-3p	CLIP-seq
MIRT2544655	hsa-miR-4721	CLIP-seq
MIRT2544656	hsa-miR-4722-3p	CLIP-seq
MIRT2544657	hsa-miR-516a-3p	CLIP-seq
MIRT2544658	hsa-miR-635	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 19369198, 19447967, 20360068, 30723163, 32296183, 32814053, 33961781
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	21399614
GO:0005813	Component	Centrosome	IEA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0007098	Process	Centrosome cycle	IMP	19427217
GO:0007098	Process	Centrosome cycle	NAS	20360068
GO:0010968	Process	Regulation of microtubule nucleation	NAS	30044976
GO:0031023	Process	Microtubule organizing center organization	IBA
GO:0031996	Function	Thioesterase binding	IPI	11163772
GO:0036064	Component	Ciliary basal body	IDA
GO:0051011	Function	Microtubule minus-end binding	IBA
GO:0051225	Process	Spindle assembly	IBA
GO:0051225	Process	Spindle assembly	IMP	19369198, 19427217
GO:0051225	Process	Spindle assembly	NAS	20360068
GO:0051301	Process	Cell division	IEA
GO:0070652	Component	HAUS complex	IBA
GO:0070652	Component	HAUS complex	IDA	19369198, 19427217
GO:0070652	Component	HAUS complex	IPI	20360068
GO:1990498	Component	Mitotic spindle microtubule	IDA	30723163

MIM	HGNC	e!Ensembl
300540	32979	ENSG00000213397

Q99871

Protein name

HAUS augmin-like complex subunit 7 (26S proteasome-associated UCH37-interacting protein 1) (UCHL5-interacting protein) (X-linked protein STS1769)

Protein function

Contributes to mitotic spindle assembly, maintenance of centrosome integrity and completion of cytokinesis as part of the HAUS augmin-like complex.

PDB

7SQK

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Detected in spleen, thymus, testis, ovary, small intestine and colon, with highest levels of expression in testis and ovary. {ECO:0000269|PubMed:11163772}.

Sequence

MGGARLGARNMAGQDAGCGRGGDDYSEDEGDSSVSRAAVEVFGKLKDLNCPFLEGLYITE
PKTIQELLCSPSEYRLEILEWMCTRVWPSLQDRFSSLKGVPTEVKIQEMTKLGHELMLCA
PDDQELLKGCACAQKQLHFMDQLLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFS
SPHLQMLLNPECDPWPLDMQPLLNKQSDDWQWASASAKSEEEEKLAELARQLQESAAKLH
ALRTEYFAQHEQGAAAGAADISTLDQKLRLVTSDFHQLILAFLQVYDDELGECCQRPGPD
LHPCGPIIQATHQNLTSYSQLLQVVMAVADTSAKAVETVKKQQGEQICWGGSSSVMSLAT
KMNELMEK

Sequence length

368

Interactions

View interactions

	Reactome
			Regulation of PLK1 Activity at G2/M Transition Loss of Nlp from mitotic centrosomes Recruitment of mitotic centrosome proteins and complexes Loss of proteins required for interphase microtubule organization from the centrosome Recruitment of NuMA to mitotic centrosomes Anchoring of the basal body to the plasma membrane AURKA Activation by TPX2

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Thyroid cancer, nonmedullary, 1	Uncertain significance	rs146365634	RCV005930984

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Lymphoma Non Hodgkin	Associate	37161065
Primary Ovarian Insufficiency	Associate	29425284

HAUS7 (HAUS augmin like complex subunit 7)