PRG2 (proteoglycan 2, pro eosinophil major basic protein)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5553
Gene name Gene Name - the full gene name approved by the HGNC.
Proteoglycan 2, pro eosinophil major basic protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PRG2
Synonyms (NCBI Gene) Gene synonyms aliases
BMPG, MBP, MBP1, proMBP
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q12.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is the predominant constituent of the crystalline core of the eosinophil granule. High levels of the proform of this protein are also present in placenta and pregnancy serum, where it exists as a complex with several other
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all(7)
miRTarBase ID miRNA Experiments Reference
MIRT1261261 hsa-miR-1827 CLIP-seq
MIRT1261262 hsa-miR-22 CLIP-seq
MIRT1261263 hsa-miR-3612 CLIP-seq
MIRT1261264 hsa-miR-4768-3p CLIP-seq
MIRT1261265 hsa-miR-4779 CLIP-seq
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all(4)
Transcription factor Regulation Reference
CEBPE Repression 12202480
GATA1 Activation 10438731;12202480
GATA2 Repression 10438731;9558404
SPI1 Activation 12202480
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all(20)
GO ID Ontology Definition Evidence Reference
GO:0002215 Process Defense response to nematode IEA
GO:0002376 Process Immune system process IEA
GO:0005515 Function Protein binding IPI 7685339, 12421832
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS 8547309
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
605601 9362 ENSG00000186652
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
UniProt ID P13727
Protein name Bone marrow proteoglycan (BMPG) (Proteoglycan 2) [Cleaved into: Eosinophil granule major basic protein (EMBP) (MBP) (Pregnancy-associated major basic protein)]
Protein function Cytotoxin and helminthotoxin. Also induces non-cytolytic histamine release from human basophils. Involved in antiparasitic defense mechanisms and immune hypersensitivity reactions. The proform acts as a proteinase inhibitor, reducing the activit
PDB 1H8U , 2BRS , 4QXX , 7Y5N , 8HGG , 9DKZ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 114 → 222 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Detected in plasma and urine (at protein level) (PubMed:25326458, PubMed:36213313, PubMed:37453717). Detected in placenta (at protein level) (PubMed:32337544). High levels of the proform in placenta and pregnancy serum; in placenta, lo
Sequence 
MKLPLLLALLFGAVSALHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEW
GSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQ
AWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRW
NFAYWAAHQPWSRGGHCVALCTRGGHWRRAHCLRRLPFICSY
Sequence length 222
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
  KEGG   Reactome
  Asthma   Neutrophil degranulation
<