PRG2 (proteoglycan 2, pro eosinophil major basic protein)

Gene

• Entrez ID: 5553
• Gene name: Proteoglycan 2, pro eosinophil major basic protein
• Gene symbol: PRG2
• Synonyms (NCBI Gene): BMPG, MBP, MBP1, proMBP
• Chromosome: 11
• Chromosome location: 11q12.1
• Summary: The protein encoded by this gene is the predominant constituent of the crystalline core of the eosinophil granule. High levels of the proform of this protein are also present in placenta and pregnancy serum, where it exists as a complex with several other

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1261261	hsa-miR-1827	CLIP-seq
MIRT1261262	hsa-miR-22	CLIP-seq
MIRT1261263	hsa-miR-3612	CLIP-seq
MIRT1261264	hsa-miR-4768-3p	CLIP-seq
MIRT1261265	hsa-miR-4779	CLIP-seq
MIRT1261266	hsa-miR-650	CLIP-seq
MIRT1261267	hsa-miR-665	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CEBPE	Repression	12202480
GATA1	Activation	10438731;12202480
GATA2	Repression	10438731;9558404
SPI1	Activation	12202480

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002215	Process	Defense response to nematode	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	7685339, 12421832
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	8547309
GO:0006955	Process	Immune response	IEA
GO:0008201	Function	Heparin binding	IEA
GO:0010936	Process	Negative regulation of macrophage cytokine production	IEA
GO:0030021	Function	Extracellular matrix structural constituent conferring compression resistance	HDA	28344315
GO:0030021	Function	Extracellular matrix structural constituent conferring compression resistance	RCA	25037231
GO:0030133	Component	Transport vesicle	IEA
GO:0030246	Function	Carbohydrate binding	IEA
GO:0030246	Function	Carbohydrate binding	TAS	1565101
GO:0031012	Component	Extracellular matrix	HDA	25037231, 28344315
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032693	Process	Negative regulation of interleukin-10 production	IEA
GO:0032753	Process	Positive regulation of interleukin-4 production	IEA
GO:0042742	Process	Defense response to bacterium	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

Other IDs

• MIM: 605601
• HGNC: 9362
• e!Ensembl: ENSG00000186652

Protein

• UniProt ID: P13727
• Protein name: Bone marrow proteoglycan (BMPG) (Proteoglycan 2) [Cleaved into: Eosinophil granule major basic protein (EMBP) (MBP) (Pregnancy-associated major basic protein)]
• Protein function: Cytotoxin and helminthotoxin. Also induces non-cytolytic histamine release from human basophils. Involved in antiparasitic defense mechanisms and immune hypersensitivity reactions. The proform acts as a proteinase inhibitor, reducing the activit
• PDB: 1H8U, 2BRS, 4QXX, 7Y5N, 8HGG, 9DKZ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00059	Lectin_C	114 → 222	Lectin C-type domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in plasma and urine (at protein level) (PubMed:25326458, PubMed:36213313, PubMed:37453717). Detected in placenta (at protein level) (PubMed:32337544). High levels of the proform in placenta and pregnancy serum; in placenta, lo
• Sequence:

  MKLPLLLALLFGAVSALHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEW
  GSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQ
  AWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRW
  NFAYWAAHQPWSRGGHCVALCTRGGHWRRAHCLRRLPFICSY

• Sequence length: 222

Pathways

KEGG:

Asthma

Reactome:

Neutrophil degranulation