Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	55509
Gene name Gene Name - the full gene name approved by the HGNC.	Basic leucine zipper ATF-like transcription factor 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	BATF3
Synonyms (NCBI Gene) Gene synonyms aliases	JDP1, JUNDM1, SNFT
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q32.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the basic leucine zipper protein family. The encoded protein functions as a transcriptional repressor when heterodimerizing with JUN. The protein may play a role in repression of interleukin-2 and matrix metalloproteinase-1 t

Show/Hide all(1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030114	hsa-miR-26b-5p	Microarray	19088304

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
FOS	Unknown	12087103
JUN	Unknown	12087103

Show/Hide all(31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	15467742
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	15467742
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	15467742
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	10878360
GO:0005515	Function	Protein binding	IPI	20102225, 20211142, 23661758, 25416956, 25609649, 28514442, 32296183, 33961781, 35271311
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	20102225, 23661758
GO:0005634	Component	Nucleus	TAS	10878360
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	20102225, 23661758
GO:0009615	Process	Response to virus	IEA
GO:0009615	Process	Response to virus	ISS
GO:0043011	Process	Myeloid dendritic cell differentiation	IEA
GO:0043011	Process	Myeloid dendritic cell differentiation	ISS
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	20102225, 23661758
GO:0097028	Process	Dendritic cell differentiation	IEA
GO:0097028	Process	Dendritic cell differentiation	ISS
GO:0140467	Process	Integrated stress response signaling	NAS	28566324
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
612470	28915	ENSG00000123685

Protein

UniProt ID

Q9NR55

Protein name

Basic leucine zipper transcriptional factor ATF-like 3 (B-ATF-3) (21 kDa small nuclear factor isolated from T-cells) (Jun dimerization protein p21SNFT)

Protein function

AP-1 family transcription factor that controls the differentiation of CD8(+) thymic conventional dendritic cells in the immune system. Required for development of CD8-alpha(+) classical dendritic cells (cDCs) and related CD103(+) dendritic cells

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00170	bZIP_1	33 → 102	bZIP transcription factor	Coiled-coil

Sequence

MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKA
DKLHEEYESLEQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDP
VAGCLPR

Sequence length

127

Interactions

View interactions

	KEGG
	PD-L1 expression and PD-1 checkpoint pathway in cancer

Show/Hide Unknown Diseases (6)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Asthma	Asthma	N/A	N/A	GWAS
Dermatitis	Atopic dermatitis	N/A	N/A	GWAS
Eczema	Eczema	N/A	N/A	GWAS
Leprosy	Leprosy	N/A	N/A	GWAS
Multiple Sclerosis	Multiple sclerosis	N/A	N/A	GWAS
T-Cell Lymphoma/Leukemia	Adult T-cell leukemia/lymphoma	Here we report genome-wide CRISPR-Cas9 screening of ATLL models, which identified CDK6, CCND2, BATF3, JUNB, STAT3, and IL10RB as genes that are essential for the proliferation and/or survival of ATLL cells.	34818414	CBGDA

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Carcinoma Pancreatic Ductal	Associate	35836806
Hereditary leiomyomatosis and renal cell cancer	Associate	12865944
Hodgkin Disease	Associate	12865944, 28878352
Lymphoma Large Cell Anaplastic	Associate	29588546
Lymphoma Primary Cutaneous Anaplastic Large Cell	Associate	37790936
Melanoma	Associate	26733611, 31308438
Myoclonic Epilepsies Progressive	Associate	28878352
Stomach Neoplasms	Associate	35874675

BATF3 (basic leucine zipper ATF-like transcription factor 3)