BATF3 (basic leucine zipper ATF-like transcription factor 3)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
55509
Gene name Gene Name - the full gene name approved by the HGNC.
Basic leucine zipper ATF-like transcription factor 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BATF3
Synonyms (NCBI Gene) Gene synonyms aliases
JDP1, JUNDM1, SNFT
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q32.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the basic leucine zipper protein family. The encoded protein functions as a transcriptional repressor when heterodimerizing with JUN. The protein may play a role in repression of interleukin-2 and matrix metalloproteinase-1 t
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
miRTarBase ID miRNA Experiments Reference
MIRT030114 hsa-miR-26b-5p Microarray 19088304
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(2)
Transcription factor Regulation Reference
FOS Unknown 12087103
JUN Unknown 12087103
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(18)
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 15467742
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 15467742
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
612470 28915 ENSG00000123685
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q9NR55
Protein name Basic leucine zipper transcriptional factor ATF-like 3 (B-ATF-3) (21 kDa small nuclear factor isolated from T-cells) (Jun dimerization protein p21SNFT)
Protein function AP-1 family transcription factor that controls the differentiation of CD8(+) thymic conventional dendritic cells in the immune system. Required for development of CD8-alpha(+) classical dendritic cells (cDCs) and related CD103(+) dendritic cells
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00170 bZIP_1 33 → 102 bZIP transcription factor Coiled-coil
Sequence 
MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKA
DKLHEEYESLEQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDP
VAGCLPR
Sequence length 127
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  
  PD-L1 expression and PD-1 checkpoint pathway in cancer  
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (5)
Unknown
Disease term Disease name Evidence References Source
Leprosy Leprosy 25642632 ClinVar, GWAS
Eczema Eczema GWAS
Multiple Sclerosis Multiple Sclerosis GWAS
Asthma Asthma GWAS
Show/Hide Text Mining Associations (8)
Associations from Text Mining
Disease Name Relationship Type References
Carcinoma Pancreatic Ductal Associate 35836806
Hereditary leiomyomatosis and renal cell cancer Associate 12865944
Hodgkin Disease Associate 12865944, 28878352
Lymphoma Large Cell Anaplastic Associate 29588546
Lymphoma Primary Cutaneous Anaplastic Large Cell Associate 37790936
Melanoma Associate 26733611, 31308438
Myoclonic Epilepsies Progressive Associate 28878352
Stomach Neoplasms Associate 35874675