BATF3 (basic leucine zipper ATF-like transcription factor 3)

Gene

• Entrez ID: 55509
• Gene name: Basic leucine zipper ATF-like transcription factor 3
• Gene symbol: BATF3
• Synonyms (NCBI Gene): JDP1, JUNDM1, SNFT
• Chromosome: 1
• Chromosome location: 1q32.3
• Summary: This gene encodes a member of the basic leucine zipper protein family. The encoded protein functions as a transcriptional repressor when heterodimerizing with JUN. The protein may play a role in repression of interleukin-2 and matrix metalloproteinase-1 t

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT030114	hsa-miR-26b-5p	Microarray	19088304

Transcription factors

Transcription factor	Regulation	Reference
FOS	Unknown	12087103
JUN	Unknown	12087103

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	15467742
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	15467742
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	15467742
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	10878360
GO:0005515	Function	Protein binding	IPI	20102225, 20211142, 23661758, 25416956, 25609649, 28514442, 32296183, 33961781, 35271311
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	20102225, 23661758
GO:0005634	Component	Nucleus	TAS	10878360
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	20102225, 23661758
GO:0009615	Process	Response to virus	IEA
GO:0009615	Process	Response to virus	ISS
GO:0043011	Process	Myeloid dendritic cell differentiation	IEA
GO:0043011	Process	Myeloid dendritic cell differentiation	ISS
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	20102225, 23661758
GO:0097028	Process	Dendritic cell differentiation	IEA
GO:0097028	Process	Dendritic cell differentiation	ISS
GO:0140467	Process	Integrated stress response signaling	NAS	28566324
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 612470
• HGNC: 28915
• e!Ensembl: ENSG00000123685

Protein

• UniProt ID: Q9NR55
• Protein name: Basic leucine zipper transcriptional factor ATF-like 3 (B-ATF-3) (21 kDa small nuclear factor isolated from T-cells) (Jun dimerization protein p21SNFT)
• Protein function: AP-1 family transcription factor that controls the differentiation of CD8(+) thymic conventional dendritic cells in the immune system. Required for development of CD8-alpha(+) classical dendritic cells (cDCs) and related CD103(+) dendritic cells
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00170	bZIP_1	33 → 102	bZIP transcription factor	Coiled-coil

• Sequence:

  MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKA
  DKLHEEYESLEQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDP
  VAGCLPR

• Sequence length: 127

Pathways

KEGG:

PD-L1 expression and PD-1 checkpoint pathway in cancer