Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
55379
Gene name Gene Name - the full gene name approved by the HGNC.
Leucine rich repeat containing 59
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LRRC59
Synonyms (NCBI Gene) Gene synonyms aliases
PRO1855, p34
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q21.33
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT020860 hsa-miR-155-5p Proteomics 18668040
MIRT020860 hsa-miR-155-5p Reporter assay;Other 20584899
MIRT025787 hsa-miR-7-5p Microarray 19073608
MIRT049898 hsa-miR-31-5p CLASH 23622248
MIRT047442 hsa-miR-10b-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding HDA 22658674
GO:0005515 Function Protein binding IPI 32296183
GO:0005635 Component Nuclear envelope IEA
GO:0005783 Component Endoplasmic reticulum IDA
GO:0005789 Component Endoplasmic reticulum membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
614854 28817 ENSG00000108829
Protein
UniProt ID Q96AG4
Protein name Leucine-rich repeat-containing protein 59 (Ribosome-binding protein p34) (p34) [Cleaved into: Leucine-rich repeat-containing protein 59, N-terminally processed]
Protein function Required for nuclear import of FGF1, but not that of FGF2. Might regulate nuclear import of exogenous FGF1 by facilitating interaction with the nuclear import machinery and by transporting cytosolic FGF1 to, and possibly through, the nuclear por
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13855 LRR_8 18 74 Leucine rich repeat Repeat
PF13855 LRR_8 62 120 Leucine rich repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:11964394}.
Sequence
MTKAGSKGGNLRDKLDGNELDLSLSDLNEVPVKELAALPKATILDLSCNKLTTLPSDFCG
L
THLVKLDLSKNKLQQLPADFGRLVNLQHLDLLNNKLVTLPVSFAQLKNLKWLDLKDNPL
DPVLAKVAGDCLDEKQCKQCANKVLQHMKAVQADQERERQRRLEVEREAEKKREAKQRAK
EAQERELRKREKAEEKERRRKEYDALKAAKREQEKKPKKEANQAPKSKSGSRPRKPPPRK
HTRSWAVLKLLLLLLLFGVAGGLVACRVTELQQQPLCTSVNTIYDNAVQGLRRHEILQWV
LQTDSQQ
Sequence length 307
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Glioblastoma Glioblastoma, Glioblastoma Multiforme rs121913500, rs886042842, rs1555138291, rs1558518449, rs1567176006, rs1558650888 30705370
Lung carcinoma Non-Small Cell Lung Carcinoma rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355
View all (44 more)
30705370
Ovarian cancer Malignant neoplasm of ovary rs34424986, rs137853060, rs28934575, rs79658334, rs121913021, rs62625308, rs80356898, rs80357579, rs41293497, rs80356904, rs80357471, rs80357522, rs80357234, rs80357912, rs80357828
View all (31 more)
30705370
Associations from Text Mining
Disease Name Relationship Type References
Ataxia Telangiectasia Associate 8246944
Carcinogenesis Associate 8246944
Colorectal Neoplasms Associate 24141722
Death Associate 25238935
HIV Infections Associate 3024760
Neoplasm Metastasis Associate 25238935
Neoplasms Inhibit 12827550
Neoplasms Associate 14645695, 26527623, 37706625
Prostatic Neoplasms Associate 25238935, 25833693, 34417538
Urinary Bladder Neoplasms Associate 37706625