Gene Gene information from NCBI Gene database.
Entrez ID 55379
Gene name Leucine rich repeat containing 59
Gene symbol LRRC59
Synonyms (NCBI Gene)
PRO1855p34
Chromosome 17
Chromosome location 17q21.33
miRNA miRNA information provided by mirtarbase database.
875
miRTarBase ID miRNA Experiments Reference
MIRT020860 hsa-miR-155-5p Proteomics 18668040
MIRT020860 hsa-miR-155-5p Reporter assay;Other 20584899
MIRT025787 hsa-miR-7-5p Microarray 19073608
MIRT049898 hsa-miR-31-5p CLASH 23622248
MIRT047442 hsa-miR-10b-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding HDA 22658674
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus IEA
GO:0005635 Component Nuclear envelope IEA
GO:0005737 Component Cytoplasm IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
614854 28817 ENSG00000108829
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96AG4
Protein name Leucine-rich repeat-containing protein 59 (Ribosome-binding protein p34) (p34) [Cleaved into: Leucine-rich repeat-containing protein 59, N-terminally processed]
Protein function Required for nuclear import of FGF1, but not that of FGF2. Might regulate nuclear import of exogenous FGF1 by facilitating interaction with the nuclear import machinery and by transporting cytosolic FGF1 to, and possibly through, the nuclear por
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13855 LRR_8 18 74 Leucine rich repeat Repeat
PF13855 LRR_8 62 120 Leucine rich repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:11964394}.
Sequence
MTKAGSKGGNLRDKLDGNELDLSLSDLNEVPVKELAALPKATILDLSCNKLTTLPSDFCG
L
THLVKLDLSKNKLQQLPADFGRLVNLQHLDLLNNKLVTLPVSFAQLKNLKWLDLKDNPL
DPVLAKVAGDCLDEKQCKQCANKVLQHMKAVQADQERERQRRLEVEREAEKKREAKQRAK
EAQERELRKREKAEEKERRRKEYDALKAAKREQEKKPKKEANQAPKSKSGSRPRKPPPRK
HTRSWAVLKLLLLLLLFGVAGGLVACRVTELQQQPLCTSVNTIYDNAVQGLRRHEILQWV
LQTDSQQ
Sequence length 307
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Ovarian serous cystadenocarcinoma Uncertain significance rs148806605 RCV005937551
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Ataxia Telangiectasia Associate 8246944
Carcinogenesis Associate 8246944
Colorectal Neoplasms Associate 24141722
Death Associate 25238935
HIV Infections Associate 3024760
Neoplasm Metastasis Associate 25238935
Neoplasms Inhibit 12827550
Neoplasms Associate 14645695, 26527623, 37706625
Prostatic Neoplasms Associate 25238935, 25833693, 34417538
Urinary Bladder Neoplasms Associate 37706625