Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5533
Gene name Gene Name - the full gene name approved by the HGNC.	Protein phosphatase 3 catalytic subunit gamma
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PPP3CC
Synonyms (NCBI Gene) Gene synonyms aliases	CALNA3, CNA3, PP2Bgamma
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8p21.3
Summary Summary of gene provided in NCBI Entrez Gene.	Calcineurin is a calcium-dependent, calmodulin-stimulated protein phosphatase involved in the downstream regulation of dopaminergic signal transduction. Calcineurin is composed of a regulatory subunit and a catalytic subunit. The protein encoded by this g

Show/Hide all(31)

miRTarBase ID	miRNA	Experiments	Reference
MIRT714710	hsa-miR-3922-5p	HITS-CLIP	19536157
MIRT714709	hsa-miR-6832-3p	HITS-CLIP	19536157
MIRT714708	hsa-miR-655-5p	HITS-CLIP	19536157
MIRT714707	hsa-miR-377-5p	HITS-CLIP	19536157
MIRT714705	hsa-miR-6086	HITS-CLIP	19536157
MIRT714706	hsa-miR-6851-3p	HITS-CLIP	19536157
MIRT714710	hsa-miR-3922-5p	HITS-CLIP	19536157
MIRT714709	hsa-miR-6832-3p	HITS-CLIP	19536157
MIRT714708	hsa-miR-655-5p	HITS-CLIP	19536157
MIRT714707	hsa-miR-377-5p	HITS-CLIP	19536157
MIRT714705	hsa-miR-6086	HITS-CLIP	19536157
MIRT714706	hsa-miR-6851-3p	HITS-CLIP	19536157
MIRT1258258	hsa-miR-2052	CLIP-seq
MIRT1258259	hsa-miR-340	CLIP-seq
MIRT1258260	hsa-miR-3616-5p	CLIP-seq
MIRT1258261	hsa-miR-3647-5p	CLIP-seq
MIRT1258262	hsa-miR-382	CLIP-seq
MIRT1258263	hsa-miR-4670-3p	CLIP-seq
MIRT1258264	hsa-miR-501-3p	CLIP-seq
MIRT1258265	hsa-miR-502-3p	CLIP-seq
MIRT1258266	hsa-miR-573	CLIP-seq
MIRT2599446	hsa-miR-3148	CLIP-seq
MIRT2599447	hsa-miR-4282	CLIP-seq
MIRT2599448	hsa-miR-4434	CLIP-seq
MIRT2599449	hsa-miR-4516	CLIP-seq
MIRT2599450	hsa-miR-4531	CLIP-seq
MIRT2599451	hsa-miR-4668-5p	CLIP-seq
MIRT2599452	hsa-miR-4802-5p	CLIP-seq
MIRT2599453	hsa-miR-549	CLIP-seq
MIRT2599454	hsa-miR-579	CLIP-seq
MIRT2599455	hsa-miR-664	CLIP-seq

Show/Hide all(20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 28514442, 32296183, 32814053
GO:0005516	Function	Calmodulin binding	IBA	21873635
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	19154138
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005955	Component	Calcineurin complex	IBA	21873635
GO:0006470	Process	Protein dephosphorylation	IDA	19154138
GO:0007420	Process	Brain development	IEA
GO:0033173	Process	Calcineurin-NFAT signaling cascade	IDA	19154138
GO:0033192	Function	Calmodulin-dependent protein phosphatase activity	IBA	21873635
GO:0033192	Function	Calmodulin-dependent protein phosphatase activity	IDA	19154138
GO:0046872	Function	Metal ion binding	IEA
GO:0097720	Process	Calcineurin-mediated signaling	IBA	21873635
GO:0098793	Component	Presynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0106306	Function	Protein serine phosphatase activity	IEA
GO:0106307	Function	Protein threonine phosphatase activity	IEA
GO:1900244	Process	Positive regulation of synaptic vesicle endocytosis	IEA
GO:1900740	Process	Positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	TAS

MIM	HGNC	e!Ensembl
114107	9316	ENSG00000120910

Protein

UniProt ID

P48454

Protein name

Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calcineurin, testis-specific catalytic subunit) (Calmodulin-dependent calcineurin A subunit gamma isoform)

Protein function

Calcium-dependent, calmodulin-stimulated protein phosphatase which plays an essential role in the transduction of intracellular Ca(2+)-mediated signals. Dephosphorylates and activates transcription factor NFATC1. Dephosphorylates and inactivates

PDB

7U0T

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00149	Metallophos	79 → 281	Calcineurin-like phosphoesterase	Domain

Tissue specificity

TISSUE SPECIFICITY: Testis. {ECO:0000269|PubMed:1339277}.

Sequence

MSGRRFHLSTTDRVIKAVPFPPTQRLTFKEVFENGKPKVDVLKNHLVKEGRLEEEVALKI
INDGAAILRQEKTMIEVDAPITVCGDIHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGY
FSIECVLYLWSLKINHPKTLFLLRGNHECRHLTDYFTFKQECRIKYSEQVYDACMETFDC
LPLAALLNQQFLCVHGGMSPEITSLDDIRKLDRFTEPPAFGPVCDLLWSDPSEDYGNEKT
LEHYTHNTVRGCSYFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQATGFPSLIT
IFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEM
LVNVLNICSDDELISDDEAEGSTTVRKEIIRNKIRAIGKMARVFSILRQESESVLTLKGL
TPTGTLPLGVLSGGKQTIETATVEAVEAREAIRGFSLQHKIRSFEEARGLDRINERMPPR
KDSIHAGGPMKSVTSAHSHAAHRSDQGKKAHS

Sequence length

512

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Calcium signaling pathway cGMP-PKG signaling pathway Oocyte meiosis Cellular senescence Wnt signaling pathway Axon guidance VEGF signaling pathway Osteoclast differentiation C-type lectin receptor signaling pathway Natural killer cell mediated cytotoxicity Th1 and Th2 cell differentiation Th17 cell differentiation T cell receptor signaling pathway B cell receptor signaling pathway Long-term potentiation Glutamatergic synapse Dopaminergic synapse Oxytocin signaling pathway Glucagon signaling pathway Renin secretion Alzheimer disease Amyotrophic lateral sclerosis Prion disease Pathways of neurodegeneration - multiple diseases Amphetamine addiction Tuberculosis Human cytomegalovirus infection Human T-cell leukemia virus 1 infection Kaposi sarcoma-associated herpesvirus infection Human immunodeficiency virus 1 infection PD-L1 expression and PD-1 checkpoint pathway in cancer Lipid and atherosclerosis		Activation of BAD and translocation to mitochondria

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	18343007, 23497497, 17339875, 24399042

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Mental depression	Mental Depression, Depressive disorder		19204725	ClinVar

Show/Hide Text Mining Associations (13)

Disease Name	Relationship Type	References
Associations from Text Mining
Brain Injuries	Associate	27225880
Carcinoma Non Small Cell Lung	Inhibit	38167059
Carcinoma Ovarian Epithelial	Associate	34573382
Hypertension	Stimulate	29237677
Mental Disorders	Associate	25571521, 27225880, 34318684
Neoplasms	Associate	18460741, 38167059
Neoplasms	Inhibit	34573382
Obesity	Associate	37399741
Pancreatic Neoplasms	Associate	33270085
Prostatic Neoplasms	Inhibit	18460741
Schizophrenia	Associate	27106592
Urinary Bladder Neoplasms	Inhibit	29275364
Urinary Bladder Neoplasms	Associate	29275364

PPP3CC (protein phosphatase 3 catalytic subunit gamma)