Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5533
Gene name	Protein phosphatase 3 catalytic subunit gamma
Gene symbol	PPP3CC
Synonyms (NCBI Gene)	CALNA3CNA3PP2Bgamma
Chromosome	8
Chromosome location	8p21.3
Summary	Calcineurin is a calcium-dependent, calmodulin-stimulated protein phosphatase involved in the downstream regulation of dopaminergic signal transduction. Calcineurin is composed of a regulatory subunit and a catalytic subunit. The protein encoded by this g

Show/Hide all (31)

miRTarBase ID	miRNA	Experiments	Reference
MIRT714710	hsa-miR-3922-5p	HITS-CLIP	19536157
MIRT714709	hsa-miR-6832-3p	HITS-CLIP	19536157
MIRT714708	hsa-miR-655-5p	HITS-CLIP	19536157
MIRT714707	hsa-miR-377-5p	HITS-CLIP	19536157
MIRT714705	hsa-miR-6086	HITS-CLIP	19536157
MIRT714706	hsa-miR-6851-3p	HITS-CLIP	19536157
MIRT714710	hsa-miR-3922-5p	HITS-CLIP	19536157
MIRT714709	hsa-miR-6832-3p	HITS-CLIP	19536157
MIRT714708	hsa-miR-655-5p	HITS-CLIP	19536157
MIRT714707	hsa-miR-377-5p	HITS-CLIP	19536157
MIRT714705	hsa-miR-6086	HITS-CLIP	19536157
MIRT714706	hsa-miR-6851-3p	HITS-CLIP	19536157
MIRT1258258	hsa-miR-2052	CLIP-seq
MIRT1258259	hsa-miR-340	CLIP-seq
MIRT1258260	hsa-miR-3616-5p	CLIP-seq
MIRT1258261	hsa-miR-3647-5p	CLIP-seq
MIRT1258262	hsa-miR-382	CLIP-seq
MIRT1258263	hsa-miR-4670-3p	CLIP-seq
MIRT1258264	hsa-miR-501-3p	CLIP-seq
MIRT1258265	hsa-miR-502-3p	CLIP-seq
MIRT1258266	hsa-miR-573	CLIP-seq
MIRT2599446	hsa-miR-3148	CLIP-seq
MIRT2599447	hsa-miR-4282	CLIP-seq
MIRT2599448	hsa-miR-4434	CLIP-seq
MIRT2599449	hsa-miR-4516	CLIP-seq
MIRT2599450	hsa-miR-4531	CLIP-seq
MIRT2599451	hsa-miR-4668-5p	CLIP-seq
MIRT2599452	hsa-miR-4802-5p	CLIP-seq
MIRT2599453	hsa-miR-549	CLIP-seq
MIRT2599454	hsa-miR-579	CLIP-seq
MIRT2599455	hsa-miR-664	CLIP-seq

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004722	Function	Protein serine/threonine phosphatase activity	IEA
GO:0004723	Function	Calcium-dependent protein serine/threonine phosphatase activity	IDA	26429887
GO:0005515	Function	Protein binding	IPI	25416956, 28514442, 32296183, 32814053, 33961781, 34446558
GO:0005516	Function	Calmodulin binding	IBA
GO:0005516	Function	Calmodulin binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	19154138
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	NAS	22343722, 28126489
GO:0005829	Component	Cytosol	TAS
GO:0005955	Component	Calcineurin complex	IBA
GO:0005955	Component	Calcineurin complex	NAS	11123943
GO:0006470	Process	Protein dephosphorylation	IDA	19154138
GO:0008287	Component	Protein serine/threonine phosphatase complex	NAS	22343722
GO:0016787	Function	Hydrolase activity	IEA
GO:0033173	Process	Calcineurin-NFAT signaling cascade	IDA	19154138
GO:0033173	Process	Calcineurin-NFAT signaling cascade	IEA
GO:0033192	Function	Calmodulin-dependent protein phosphatase activity	IBA
GO:0033192	Function	Calmodulin-dependent protein phosphatase activity	IDA	19154138
GO:0033192	Function	Calmodulin-dependent protein phosphatase activity	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0070886	Process	Positive regulation of calcineurin-NFAT signaling cascade	NAS	8631904, 22343722
GO:0097720	Process	Calcineurin-mediated signaling	IBA
GO:0097720	Process	Calcineurin-mediated signaling	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:1900242	Process	Regulation of synaptic vesicle endocytosis	IEA
GO:1900244	Process	Positive regulation of synaptic vesicle endocytosis	IEA
GO:1905665	Process	Positive regulation of calcium ion import across plasma membrane	NAS	17640527
GO:1905949	Process	Negative regulation of calcium ion import across plasma membrane	NAS	17640527

MIM	HGNC	e!Ensembl
114107	9316	ENSG00000120910

P48454

Protein name

Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calcineurin, testis-specific catalytic subunit) (Calmodulin-dependent calcineurin A subunit gamma isoform)

Protein function

Calcium-dependent, calmodulin-stimulated protein phosphatase which plays an essential role in the transduction of intracellular Ca(2+)-mediated signals. Dephosphorylates and activates transcription factor NFATC1. Dephosphorylates and inactivates

PDB

7U0T

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00149	Metallophos	79 → 281	Calcineurin-like phosphoesterase	Domain

Tissue specificity

TISSUE SPECIFICITY: Testis. {ECO:0000269|PubMed:1339277}.

Sequence

MSGRRFHLSTTDRVIKAVPFPPTQRLTFKEVFENGKPKVDVLKNHLVKEGRLEEEVALKI
INDGAAILRQEKTMIEVDAPITVCGDIHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGY
FSIECVLYLWSLKINHPKTLFLLRGNHECRHLTDYFTFKQECRIKYSEQVYDACMETFDC
LPLAALLNQQFLCVHGGMSPEITSLDDIRKLDRFTEPPAFGPVCDLLWSDPSEDYGNEKT
LEHYTHNTVRGCSYFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQATGFPSLIT
IFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEM
LVNVLNICSDDELISDDEAEGSTTVRKEIIRNKIRAIGKMARVFSILRQESESVLTLKGL
TPTGTLPLGVLSGGKQTIETATVEAVEAREAIRGFSLQHKIRSFEEARGLDRINERMPPR
KDSIHAGGPMKSVTSAHSHAAHRSDQGKKAHS

Sequence length

512

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Calcium signaling pathway cGMP-PKG signaling pathway Oocyte meiosis Cellular senescence Wnt signaling pathway Axon guidance VEGF signaling pathway Osteoclast differentiation C-type lectin receptor signaling pathway Natural killer cell mediated cytotoxicity Th1 and Th2 cell differentiation Th17 cell differentiation T cell receptor signaling pathway B cell receptor signaling pathway Long-term potentiation Glutamatergic synapse Dopaminergic synapse Oxytocin signaling pathway Glucagon signaling pathway Renin secretion Alzheimer disease Amyotrophic lateral sclerosis Prion disease Pathways of neurodegeneration - multiple diseases Amphetamine addiction Tuberculosis Human cytomegalovirus infection Human T-cell leukemia virus 1 infection Kaposi sarcoma-associated herpesvirus infection Human immunodeficiency virus 1 infection PD-L1 expression and PD-1 checkpoint pathway in cancer Lipid and atherosclerosis		Activation of BAD and translocation to mitochondria

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Keratoconus	Uncertain significance	rs1563790727	RCV000678667

Show/Hide Text Mining Associations (13)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Brain Injuries	Associate	27225880
Carcinoma Non Small Cell Lung	Inhibit	38167059
Carcinoma Ovarian Epithelial	Associate	34573382
Hypertension	Stimulate	29237677
Mental Disorders	Associate	25571521, 27225880, 34318684
Neoplasms	Associate	18460741, 38167059
Neoplasms	Inhibit	34573382
Obesity	Associate	37399741
Pancreatic Neoplasms	Associate	33270085
Prostatic Neoplasms	Inhibit	18460741
Schizophrenia	Associate	27106592
Urinary Bladder Neoplasms	Inhibit	29275364
Urinary Bladder Neoplasms	Associate	29275364

PPP3CC (protein phosphatase 3 catalytic subunit gamma)