Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	55325
Gene name Gene Name - the full gene name approved by the HGNC.	UFM1 specific peptidase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	UFSP2
Synonyms (NCBI Gene) Gene synonyms aliases	BHD, C4orf20, DEE106, SEMDDR
Disease Acronyms (UniProt) Disease acronyms from UniProt database	DEE106, SEMDDR
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4q35.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a highly conserved cysteine protease. The protein cleaves two C-terminal residues from ubiquitin-fold modifier 1, a ubiquitin-like post-translational modifier protein. Activation of ubiquitin-fold modifier 1 by the encoded protein expose

Show/Hide all(49)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029446	hsa-miR-26b-5p	Microarray	19088304
MIRT051057	hsa-miR-16-5p	CLASH	23622248
MIRT049780	hsa-miR-92a-3p	CLASH	23622248
MIRT035904	hsa-miR-1287-5p	CLASH	23622248
MIRT2142428	hsa-miR-1244	CLIP-seq
MIRT2142429	hsa-miR-1298	CLIP-seq
MIRT2142430	hsa-miR-3143	CLIP-seq
MIRT2142431	hsa-miR-325	CLIP-seq
MIRT2142432	hsa-miR-543	CLIP-seq
MIRT2142433	hsa-miR-628-3p	CLIP-seq
MIRT2142428	hsa-miR-1244	CLIP-seq
MIRT2142431	hsa-miR-325	CLIP-seq
MIRT2362946	hsa-miR-3691-3p	CLIP-seq
MIRT2362947	hsa-miR-4659a-3p	CLIP-seq
MIRT2362948	hsa-miR-4659b-3p	CLIP-seq
MIRT2362949	hsa-miR-4699-5p	CLIP-seq
MIRT2362950	hsa-miR-548ae	CLIP-seq
MIRT2362951	hsa-miR-548aj	CLIP-seq
MIRT2362952	hsa-miR-548am	CLIP-seq
MIRT2362953	hsa-miR-548x	CLIP-seq
MIRT2142433	hsa-miR-628-3p	CLIP-seq
MIRT2142428	hsa-miR-1244	CLIP-seq
MIRT2656992	hsa-miR-1278	CLIP-seq
MIRT2142429	hsa-miR-1298	CLIP-seq
MIRT2656993	hsa-miR-1976	CLIP-seq
MIRT2656994	hsa-miR-205	CLIP-seq
MIRT2656995	hsa-miR-3140-3p	CLIP-seq
MIRT2142430	hsa-miR-3143	CLIP-seq
MIRT2656996	hsa-miR-3185	CLIP-seq
MIRT2142431	hsa-miR-325	CLIP-seq
MIRT2656997	hsa-miR-370	CLIP-seq
MIRT2656998	hsa-miR-4762-5p	CLIP-seq
MIRT2142432	hsa-miR-543	CLIP-seq
MIRT2656999	hsa-miR-579	CLIP-seq
MIRT2657000	hsa-miR-614	CLIP-seq
MIRT2142433	hsa-miR-628-3p	CLIP-seq
MIRT2142428	hsa-miR-1244	CLIP-seq
MIRT2142429	hsa-miR-1298	CLIP-seq
MIRT2142430	hsa-miR-3143	CLIP-seq
MIRT2694730	hsa-miR-3199	CLIP-seq
MIRT2142431	hsa-miR-325	CLIP-seq
MIRT2694731	hsa-miR-4786-5p	CLIP-seq
MIRT2694732	hsa-miR-518d-5p	CLIP-seq
MIRT2694733	hsa-miR-519b-5p	CLIP-seq
MIRT2694734	hsa-miR-519c-5p	CLIP-seq
MIRT2694735	hsa-miR-520c-5p	CLIP-seq
MIRT2694736	hsa-miR-526a	CLIP-seq
MIRT2142432	hsa-miR-543	CLIP-seq
MIRT2142433	hsa-miR-628-3p	CLIP-seq

Show/Hide all(8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25219498, 32296183
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	ISS
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0006508	Process	Proteolysis	IMP	25219498
GO:0016790	Function	Thiolester hydrolase activity	IMP	25219498
GO:0033146	Process	Regulation of intracellular estrogen receptor signaling pathway	IMP	25219498
GO:0071567	Function	UFM1 hydrolase activity	IMP	25219498, 32160526

MIM	HGNC	e!Ensembl
611482	25640	ENSG00000109775

Protein

UniProt ID

Q9NUQ7

Protein name

Ufm1-specific protease 2 (UfSP2) (EC 3.4.22.-)

Protein function

Thiol-dependent isopeptidase that specifically cleaves UFM1, a ubiquitin-like modifier protein, from conjugated proteins, such as CD274/PD-L1, CYB5R3, DDRGK1, MRE11, RPL26/uL24, TRIP4 and RPL26/uL24 (PubMed:25219498, PubMed:27351204, PubMed:2792

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07910	Peptidase_C78	276 → 461	Peptidase family C78	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain. {ECO:0000269|PubMed:33473208}.

Sequence

MVISESMDILFRIRGGLDLAFQLATPNEIFLKKALKHVLSDLSTKLSSNALVFRICHSSV
YIWPSSDINTIPGELTDASACKNILRFIQFEPEEDIKRKFMRKKDKKLSDMHQIVNIDLM
LEMSTSLAAVTPIIERESGGHHYVNMTLPVDAVISVAPEETWGKVRKLLVDAIHNQLTDM
EKCILKYMKGTSIVVPEPLHFLLPGKKNLVTISYPSGIPDGQLQAYRKELHDLFNLPHDR
PYFKRSNAYHFPDEPYKDGYIRNPHTYLNPPNMETGMIYVVQGIYGYHHYMQDRIDDNGW
GCAYRSLQTICSWFKHQGYTERSIPTHREIQQALVDAGDKPATFVGSRQWIGSIEVQLVL
NQLIGITSKILFVSQGSEIASQGRELANHFQSEGTPVMIGGGVLAHTILGVAWNEITGQI
KFLILDPHYTGAEDLQVILEKGWCGWKGPDFWNKDAYYNLCLPQRPNMI

Sequence length

469

Interactions

View interactions

Show/Hide Causal Diseases (5)

Disease term	Disease name	dbSNP ID	References
Causal
Arthritis	Degenerative polyarthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470
Hip dysplasia	HIP DYSPLASIA, BEUKES TYPE	rs796052130, rs1554022725	26428751, 28892125
Pyle metaphyseal dysplasia	Pyle metaphyseal dysplasia	rs879255603, rs755007671, rs879253778
Scoliosis	Scoliosis, unspecified	rs1057518828, rs147296805, rs758163506, rs1555613564, rs1596852902, rs1596853067, rs1596853085
Spondyloenchondrodysplasia	SPONDYLOEPIMETAPHYSEAL DYSPLASIA, DI ROCCO TYPE	rs121908616, rs267606734, rs121908617, rs121908618, rs1589509884, rs121908619, rs121908620, rs145538723, rs267606733, rs267606732, rs587776752, rs121912870, rs121912871, rs121912875, rs121912880 View all (39 more)	21228277, 28892125

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Epileptic encephalopathy	developmental and epileptic encephalopathy 106	GenCC
Non-Syndromic Intellectual Disability	autosomal recessive non-syndromic intellectual disability	GenCC

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References
Associations from Text Mining
Epilepsy	Associate	33473208
HEM dysplasia	Associate	33473208
Hypersensitivity Delayed	Associate	33473208
Learning Disabilities	Associate	33473208
Microcephaly with Mental Retardation and Digital Anomalies	Associate	33473208
Myotonia with Skeletal Abnormalities and Mental Retardation	Associate	33473208
Vision Disorders	Associate	26350515

UFSP2 (UFM1 specific peptidase 2)