Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5530
Gene name Gene Name - the full gene name approved by the HGNC.
Protein phosphatase 3 catalytic subunit alpha
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PPP3CA
Synonyms (NCBI Gene) Gene synonyms aliases
ACCIID, CALN, CALNA, CALNA1, CCN1, CNA1, DEE91, IECEE, IECEE1, PPP2B
Disease Acronyms (UniProt) Disease acronyms from UniProt database
ACCIID, IECEE1
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q24
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs199706529 G>A,C Pathogenic Coding sequence variant, synonymous variant, missense variant
rs1553920188 T>C Likely-pathogenic Intron variant, splice acceptor variant
rs1553920374 C>T Pathogenic Coding sequence variant, missense variant
rs1553920376 G>A Pathogenic Stop gained, coding sequence variant
rs1553920379 ->AGTA Pathogenic Coding sequence variant, frameshift variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT000677 hsa-miR-145-5p qRT-PCR, Luciferase reporter assay, Microarray 19915607
MIRT005198 hsa-miR-30a-5p pSILAC 18668040
MIRT000677 hsa-miR-145-5p Reporter assay;Other 19915607
MIRT005198 hsa-miR-30a-5p Proteomics;Other 18668040
MIRT053196 hsa-miR-181a-5p Luciferase reporter assay 23677691
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000082 Process G1/S transition of mitotic cell cycle IEA
GO:0001975 Process Response to amphetamine IEA
GO:0004722 Function Protein serine/threonine phosphatase activity IMP 30611118
GO:0004722 Function Protein serine/threonine phosphatase activity NAS 8392375
GO:0005509 Function Calcium ion binding NAS 8392375
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
114105 9314 ENSG00000138814
Protein
UniProt ID Q08209
Protein name Protein phosphatase 3 catalytic subunit alpha (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calcineurin A alpha) (Calmodulin-dependent calcineurin A subunit alpha isoform) (CNA alpha) (Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform)
Protein function Calcium-dependent, calmodulin-stimulated protein phosphatase which plays an essential role in the transduction of intracellular Ca(2+)-mediated signals (PubMed:15671020, PubMed:18838687, PubMed:19154138, PubMed:23468591, PubMed:30254215). Many o
PDB 1AUI , 1M63 , 1MF8 , 2JOG , 2JZI , 2P6B , 2R28 , 2W73 , 3LL8 , 4F0Z , 4Q5U , 5C1V , 5SVE , 6NUC , 6NUF , 6NUU , 6UUQ , 9B9G
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00149 Metallophos 83 285 Calcineurin-like phosphoesterase Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in keratinocytes (at protein level) (PubMed:29043977). Expressed in lymphoblasts (at protein level) (PubMed:30254215). {ECO:0000269|PubMed:29043977, ECO:0000269|PubMed:30254215}.
Sequence
MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESV
ALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYV
DRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMD
AFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFG
NEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQD
AGYRMYRKSQTTGFP
SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESV
LTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRIN
ERMPPRRDAMPSDANLNSINKALTSETNGTDSNGSNSSNIQ
Sequence length 521
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  MAPK signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Oocyte meiosis
Cellular senescence
Wnt signaling pathway
Axon guidance
VEGF signaling pathway
Osteoclast differentiation
C-type lectin receptor signaling pathway
Natural killer cell mediated cytotoxicity
Th1 and Th2 cell differentiation
Th17 cell differentiation
T cell receptor signaling pathway
B cell receptor signaling pathway
Long-term potentiation
Glutamatergic synapse
Dopaminergic synapse
Oxytocin signaling pathway
Glucagon signaling pathway
Renin secretion
Alzheimer disease
Amyotrophic lateral sclerosis
Prion disease
Pathways of neurodegeneration - multiple diseases
Amphetamine addiction
Tuberculosis
Human cytomegalovirus infection
Human T-cell leukemia virus 1 infection
Kaposi sarcoma-associated herpesvirus infection
Human immunodeficiency virus 1 infection
PD-L1 expression and PD-1 checkpoint pathway in cancer
Lipid and atherosclerosis
  Calcineurin activates NFAT
FCERI mediated Ca+2 mobilization
Ca2+ pathway
CLEC7A (Dectin-1) induces NFAT activation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Arthrogryposis multiplex congenita Arthrogryposis rs1586285494, rs80358233, rs137853305, rs1559154278, rs398124167, rs398124172, rs587780399, rs786204576, rs786204430, rs769345284, rs749355583, rs793888524, rs793888525, rs878854368, rs555445835
View all (138 more)
Arthrogryposis, cleft palate, craniosynostosis, and impaired intellectual development Craniosynostosis-microretrognathia-severe intellectual disability syndrome, ARTHROGRYPOSIS, CLEFT PALATE, CRANIOSYNOSTOSIS, AND IMPAIRED INTELLECTUAL DEVELOPMENT rs1560567347, rs1560567337 29432562
Attention deficit hyperactivity disorder Attention deficit hyperactivity disorder rs786205019
Autism Autistic Disorder rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699
View all (8 more)
Unknown
Disease term Disease name Evidence References Source
Pancreatitis Pancreatitis 22952646 ClinVar
Ptosis Blepharoptosis, Ptosis ClinVar
Trigonocephaly Trigonocephaly ClinVar
Non-Syndromic Intellectual Disability autosomal dominant non-syndromic intellectual disability GenCC
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 27158780
Alzheimer Disease Associate 20590401
Anorexia Nervosa Associate 24514567
Arthrogryposis Associate 32593294
Body Dysmorphic Disorders Associate 30254215
Brain Diseases Associate 30254215, 30455226, 32593294
Breast Neoplasms Associate 34711683
Carcinoma Hepatocellular Associate 23317196
Cleft Palate Associate 32593294
Colitis Ulcerative Associate 35058554