Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	55294
Gene name Gene Name - the full gene name approved by the HGNC.	F-box and WD repeat domain containing 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FBXW7
Synonyms (NCBI Gene) Gene synonyms aliases	AGO, CDC4, DEDHIL, FBW6, FBW7, FBX30, FBXO30, FBXW6, SEL-10, SEL10, hAgo, hCdc4
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4q31.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), w

Show/Hide all(7)

SNP ID	Visualize variation	Clinical significance	Consequence
rs149680468	G>A,C,T	Likely-pathogenic	Coding sequence variant, genic downstream transcript variant, missense variant
rs747241612	G>C	Likely-pathogenic	Missense variant, coding sequence variant, genic downstream transcript variant
rs759610249	C>T	Likely-pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs866987936	C>A,G,T	Likely-pathogenic	Genic downstream transcript variant, coding sequence variant, missense variant
rs867384286	G>A,C	Likely-pathogenic	Genic downstream transcript variant, coding sequence variant, missense variant
rs1057519895	C>A,G,T	Likely-pathogenic	Genic downstream transcript variant, coding sequence variant, missense variant
rs1057519896	C>A,T	Likely-pathogenic, uncertain-significance	Genic downstream transcript variant, coding sequence variant, missense variant

Show/Hide all(607)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004756	hsa-miR-107	Luciferase reporter assay, Microarray, Northern blot, Western blot	20042474
MIRT004757	hsa-miR-128-3p	Luciferase reporter assay, Microarray, Northern blot, Western blot	20042474
MIRT003827	hsa-miR-197-3p	Microarray	16822819
MIRT006237	hsa-miR-223-3p	Luciferase reporter assay, qRT-PCR, Western blot	22270966
MIRT006357	hsa-miR-27a-3p	Luciferase reporter assay, Western blot	21460851
MIRT006357	hsa-miR-27a-3p	Luciferase reporter assay, Western blot	21460851
MIRT006357	hsa-miR-27a-3p	Luciferase reporter assay, Western blot	21460851
MIRT006357	hsa-miR-27a-3p	Luciferase reporter assay, Western blot	21460851
MIRT006357	hsa-miR-27a-3p	Luciferase reporter assay, Western blot	21460851
MIRT006357	hsa-miR-27a-3p	Luciferase reporter assay, Western blot	21460851
MIRT006357	hsa-miR-27a-3p	Luciferase reporter assay, Western blot	21460851
MIRT006357	hsa-miR-27a-3p	Luciferase reporter assay, Western blot	21460851
MIRT006237	hsa-miR-223-3p	Luciferase reporter assay, qRT-PCR, Western blot	22270966
MIRT006357	hsa-miR-27a-3p	Luciferase reporter assay, Western blot	21460851
MIRT006357	hsa-miR-27a-3p	Luciferase reporter assay, Western blot	21460851
MIRT006357	hsa-miR-27a-3p	Luciferase reporter assay, Western blot	21460851
MIRT006357	hsa-miR-27a-3p	Luciferase reporter assay, Western blot	21460851
MIRT006237	hsa-miR-223-3p	Luciferase reporter assay, qRT-PCR, Western blot	22270966
MIRT016198	hsa-miR-590-3p	Sequencing	20371350
MIRT004757	hsa-miR-128-3p	Sequencing	20371350
MIRT027232	hsa-miR-103a-3p	Sequencing	20371350
MIRT027385	hsa-miR-101-3p	Sequencing	20371350
MIRT006357	hsa-miR-27a-3p	Sequencing	20371350
MIRT032006	hsa-miR-16-5p	Sequencing	20371350
MIRT437907	hsa-miR-503-5p	Luciferase reporter assay, Western blot	25269767
MIRT437907	hsa-miR-503-5p	Luciferase reporter assay, Western blot	25269767
MIRT437908	hsa-miR-182-5p	Luciferase reporter assay, Western blot	25269767
MIRT437908	hsa-miR-182-5p	Luciferase reporter assay, Western blot	25269767
MIRT437908	hsa-miR-182-5p	Luciferase reporter assay, Western blot	25269767
MIRT437908	hsa-miR-182-5p	Luciferase reporter assay, Western blot	25269767
MIRT006237	hsa-miR-223-3p	Flow, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	25159729
MIRT006237	hsa-miR-223-3p	Flow, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	25159729
MIRT006237	hsa-miR-223-3p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	25888377
MIRT006237	hsa-miR-223-3p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	25888377
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, qRT-PCR, Western blot	25944166
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, qRT-PCR, Western blot	25944166
MIRT006237	hsa-miR-223-3p	Luciferase reporter assay	24324762
MIRT006237	hsa-miR-223-3p	Flow, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	25159729
MIRT006237	hsa-miR-223-3p	Flow, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	25159729
MIRT006237	hsa-miR-223-3p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	25888377
MIRT006237	hsa-miR-223-3p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	25888377
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, qRT-PCR, Western blot	25944166
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, qRT-PCR, Western blot	25944166
MIRT006237	hsa-miR-223-3p	Luciferase reporter assay	24324762
MIRT548250	hsa-miR-5694	PAR-CLIP	21572407
MIRT548249	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT548248	hsa-miR-656-3p	PAR-CLIP	21572407
MIRT548247	hsa-miR-4495	PAR-CLIP	21572407
MIRT548246	hsa-miR-379-3p	PAR-CLIP	21572407
MIRT548245	hsa-miR-411-3p	PAR-CLIP	21572407
MIRT548244	hsa-miR-380-3p	PAR-CLIP	21572407
MIRT548242	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT548243	hsa-miR-579-3p	PAR-CLIP	21572407
MIRT548241	hsa-miR-664b-3p	PAR-CLIP	21572407
MIRT548240	hsa-miR-1303	PAR-CLIP	21572407
MIRT476888	hsa-miR-203a-3p	PAR-CLIP	23592263
MIRT476888	hsa-miR-203a-3p	PAR-CLIP	23592263
MIRT476887	hsa-miR-548ag	PAR-CLIP	23592263
MIRT476886	hsa-miR-548ai	PAR-CLIP	23592263
MIRT476885	hsa-miR-548ba	PAR-CLIP	23592263
MIRT476884	hsa-miR-570-5p	PAR-CLIP	23592263
MIRT476883	hsa-miR-4698	PAR-CLIP	23592263
MIRT476882	hsa-miR-4328	PAR-CLIP	23592263
MIRT476881	hsa-miR-2052	PAR-CLIP	23592263
MIRT476880	hsa-miR-4639-5p	PAR-CLIP	23592263
MIRT476879	hsa-miR-510-3p	PAR-CLIP	23592263
MIRT440649	ebv-miR-BART10-3p	HITS-CLIP	22473208
MIRT440649	ebv-miR-BART10-3p	HITS-CLIP	22473208
MIRT438342	hsa-miR-25-3p	Western blot, Immunofluorescence, Immunohistochemistry	25512615
MIRT438342	hsa-miR-25-3p	Western blot, Immunofluorescence, Immunohistochemistry	25512615
MIRT731444	hsa-miR-32-5p	Luciferase reporter assay, qRT-PCR, Western blot	28149200
MIRT731444	hsa-miR-32-5p	Luciferase reporter assay, qRT-PCR, Western blot	28149200
MIRT731599	hsa-miR-92a-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26323375
MIRT731599	hsa-miR-92a-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26323375
MIRT006357	hsa-miR-27a-3p	Luciferase reporter assay, Western blot	26629048
MIRT006357	hsa-miR-27a-3p	Luciferase reporter assay, Western blot	26629048
MIRT732430	hsa-miR-384	Luciferase reporter assay, qRT-PCR, Western blot	27769041
MIRT732430	hsa-miR-384	Luciferase reporter assay, qRT-PCR, Western blot	27769041
MIRT737154	hsa-miR-182-3p	Luciferase reporter assay, qRT-PCR, Western blot	27648365
MIRT731599	hsa-miR-92a-3p	Luciferase reporter assay, qRT-PCR, Western blot	28069547
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, Western blot	26464659
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, Western blot	26464659
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, Western blot	26464659
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, Western blot	26464659
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, Western blot	26464659
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, Western blot	26464659
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, Western blot	26464659
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, Western blot	26464659
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, Western blot	26464659
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, Western blot	26464659
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, Western blot	26464659
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, Western blot	26464659
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, Western blot	26464659
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, Western blot	26464659
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, Western blot	26464659
MIRT006237	hsa-miR-223-3p	qRT-PCR, Western blot	28000896
MIRT027385	hsa-miR-101-3p	PAR-CLIP	26701625
MIRT027385	hsa-miR-101-3p	PAR-CLIP	26701625
MIRT027385	hsa-miR-101-3p	PAR-CLIP	26701625
MIRT027385	hsa-miR-101-3p	PAR-CLIP	26701625
MIRT027385	hsa-miR-101-3p	PAR-CLIP	26701625
MIRT027385	hsa-miR-101-3p	PAR-CLIP	26701625
MIRT027385	hsa-miR-101-3p	PAR-CLIP	26701625
MIRT027385	hsa-miR-101-3p	PAR-CLIP	26701625
MIRT027385	hsa-miR-101-3p	PAR-CLIP	26701625
MIRT737058	hsa-miR-144-3p	PAR-CLIP	26701625
MIRT737058	hsa-miR-144-3p	PAR-CLIP	26701625
MIRT737058	hsa-miR-144-3p	PAR-CLIP	26701625
MIRT737058	hsa-miR-144-3p	PAR-CLIP	26701625
MIRT737058	hsa-miR-144-3p	PAR-CLIP	26701625
MIRT737058	hsa-miR-144-3p	PAR-CLIP	26701625
MIRT737058	hsa-miR-144-3p	PAR-CLIP	26701625
MIRT737058	hsa-miR-144-3p	PAR-CLIP	26701625
MIRT737058	hsa-miR-144-3p	PAR-CLIP	26701625
MIRT027385	hsa-miR-101-3p	PAR-CLIP	27292025
MIRT737058	hsa-miR-144-3p	PAR-CLIP	27292025
MIRT438342	hsa-miR-25-3p	Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR, Western blotting	34278448
MIRT438342	hsa-miR-25-3p	Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR, Western blotting	34278448
MIRT438342	hsa-miR-25-3p	Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR, Western blotting	34278448
MIRT006357	hsa-miR-27a-3p	Immunofluorescence, Luciferase reporter assay, Microarray, qRT-PCR, Western blotting	32159214
MIRT027385	hsa-miR-101-3p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), qRT-PCR	33438204
MIRT735235	hsa-miR-500a-3p	Luciferase reporter assay, Western blotting, Immunofluorescence, qRT-PCR	32588541
MIRT731599	hsa-miR-92a-3p	Luciferase reporter assay, Western blotting, qRT-PCR	32945381
MIRT438342	hsa-miR-25-3p	qRT-PCR, Immunocytochemistry (ICC)	33886022
MIRT737058	hsa-miR-144-3p	Luciferase reporter assay, Western blotting, qRT-PCR, ELISA	34094717
MIRT737154	hsa-miR-182-3p	Microarray	33884382
MIRT548250	hsa-miR-5694	PAR-CLIP	21572407
MIRT548249	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT548248	hsa-miR-656-3p	PAR-CLIP	21572407
MIRT548247	hsa-miR-4495	PAR-CLIP	21572407
MIRT548246	hsa-miR-379-3p	PAR-CLIP	21572407
MIRT548245	hsa-miR-411-3p	PAR-CLIP	21572407
MIRT548244	hsa-miR-380-3p	PAR-CLIP	21572407
MIRT548242	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT548243	hsa-miR-579-3p	PAR-CLIP	21572407
MIRT548241	hsa-miR-664b-3p	PAR-CLIP	21572407
MIRT548240	hsa-miR-1303	PAR-CLIP	21572407
MIRT476888	hsa-miR-203a-3p	PAR-CLIP	23592263
MIRT476888	hsa-miR-203a-3p	PAR-CLIP	23592263
MIRT476887	hsa-miR-548ag	PAR-CLIP	23592263
MIRT476886	hsa-miR-548ai	PAR-CLIP	23592263
MIRT476885	hsa-miR-548ba	PAR-CLIP	23592263
MIRT476884	hsa-miR-570-5p	PAR-CLIP	23592263
MIRT476883	hsa-miR-4698	PAR-CLIP	23592263
MIRT476882	hsa-miR-4328	PAR-CLIP	23592263
MIRT476881	hsa-miR-2052	PAR-CLIP	23592263
MIRT476880	hsa-miR-4639-5p	PAR-CLIP	23592263
MIRT476879	hsa-miR-510-3p	PAR-CLIP	23592263
MIRT027232	hsa-miR-103a-3p	Luciferase reporter assay, Western blotting, qRT-PCR	35094292
MIRT755914	hsa-miR-92b-3p	Luciferase reporter assay, Western blotting, qRT-PCR	37752997
MIRT993463	hsa-miR-101	CLIP-seq
MIRT993464	hsa-miR-1238	CLIP-seq
MIRT993465	hsa-miR-144	CLIP-seq
MIRT993466	hsa-miR-188-5p	CLIP-seq
MIRT993467	hsa-miR-200b	CLIP-seq
MIRT993468	hsa-miR-200c	CLIP-seq
MIRT993469	hsa-miR-204	CLIP-seq
MIRT993470	hsa-miR-211	CLIP-seq
MIRT993471	hsa-miR-223	CLIP-seq
MIRT993472	hsa-miR-3187-3p	CLIP-seq
MIRT993473	hsa-miR-3192	CLIP-seq
MIRT993474	hsa-miR-3975	CLIP-seq
MIRT993475	hsa-miR-429	CLIP-seq
MIRT993476	hsa-miR-4318	CLIP-seq
MIRT993477	hsa-miR-4435	CLIP-seq
MIRT993478	hsa-miR-4679	CLIP-seq
MIRT993479	hsa-miR-4691-5p	CLIP-seq
MIRT993480	hsa-miR-4693-5p	CLIP-seq
MIRT993481	hsa-miR-4697-3p	CLIP-seq
MIRT993482	hsa-miR-489	CLIP-seq
MIRT993483	hsa-miR-548m	CLIP-seq
MIRT993484	hsa-miR-548s	CLIP-seq
MIRT993485	hsa-miR-892a	CLIP-seq
MIRT993463	hsa-miR-101	CLIP-seq
MIRT993486	hsa-miR-103a	CLIP-seq
MIRT993487	hsa-miR-1226	CLIP-seq
MIRT993488	hsa-miR-1236	CLIP-seq
MIRT993489	hsa-miR-1267	CLIP-seq
MIRT993490	hsa-miR-1270	CLIP-seq
MIRT993491	hsa-miR-128	CLIP-seq
MIRT993492	hsa-miR-1290	CLIP-seq
MIRT993493	hsa-miR-1298	CLIP-seq
MIRT993494	hsa-miR-1305	CLIP-seq
MIRT993495	hsa-miR-137	CLIP-seq
MIRT993465	hsa-miR-144	CLIP-seq
MIRT993496	hsa-miR-146a	CLIP-seq
MIRT993497	hsa-miR-146b-5p	CLIP-seq
MIRT993498	hsa-miR-15a	CLIP-seq
MIRT993499	hsa-miR-15b	CLIP-seq
MIRT993500	hsa-miR-16	CLIP-seq
MIRT993501	hsa-miR-1827	CLIP-seq
MIRT993502	hsa-miR-195	CLIP-seq
MIRT993467	hsa-miR-200b	CLIP-seq
MIRT993468	hsa-miR-200c	CLIP-seq
MIRT993503	hsa-miR-219-1-3p	CLIP-seq
MIRT993471	hsa-miR-223	CLIP-seq
MIRT993504	hsa-miR-25	CLIP-seq
MIRT993505	hsa-miR-27a	CLIP-seq
MIRT993506	hsa-miR-27b	CLIP-seq
MIRT993507	hsa-miR-29a	CLIP-seq
MIRT993508	hsa-miR-29b	CLIP-seq
MIRT993509	hsa-miR-29c	CLIP-seq
MIRT993510	hsa-miR-3121-3p	CLIP-seq
MIRT993511	hsa-miR-3130-3p	CLIP-seq
MIRT993512	hsa-miR-3136-5p	CLIP-seq
MIRT993513	hsa-miR-3137	CLIP-seq
MIRT993514	hsa-miR-3145-3p	CLIP-seq
MIRT993515	hsa-miR-3183	CLIP-seq
MIRT993472	hsa-miR-3187-3p	CLIP-seq
MIRT993516	hsa-miR-3189-5p	CLIP-seq
MIRT993473	hsa-miR-3192	CLIP-seq
MIRT993517	hsa-miR-32	CLIP-seq
MIRT993518	hsa-miR-3200-5p	CLIP-seq
MIRT993519	hsa-miR-338-3p	CLIP-seq
MIRT993520	hsa-miR-3609	CLIP-seq
MIRT993521	hsa-miR-363	CLIP-seq
MIRT993522	hsa-miR-3655	CLIP-seq
MIRT993523	hsa-miR-367	CLIP-seq
MIRT993524	hsa-miR-3682-5p	CLIP-seq
MIRT993525	hsa-miR-3688-3p	CLIP-seq
MIRT993474	hsa-miR-3975	CLIP-seq
MIRT993526	hsa-miR-424	CLIP-seq
MIRT993527	hsa-miR-4251	CLIP-seq
MIRT993528	hsa-miR-4264	CLIP-seq
MIRT993475	hsa-miR-429	CLIP-seq
MIRT993529	hsa-miR-4290	CLIP-seq
MIRT993476	hsa-miR-4318	CLIP-seq
MIRT993530	hsa-miR-432	CLIP-seq
MIRT993531	hsa-miR-4423-5p	CLIP-seq
MIRT993532	hsa-miR-4434	CLIP-seq
MIRT993477	hsa-miR-4435	CLIP-seq
MIRT993533	hsa-miR-4439	CLIP-seq
MIRT993534	hsa-miR-4470	CLIP-seq
MIRT993535	hsa-miR-4474-3p	CLIP-seq
MIRT993536	hsa-miR-4474-5p	CLIP-seq
MIRT993537	hsa-miR-4516	CLIP-seq
MIRT993538	hsa-miR-452	CLIP-seq
MIRT993539	hsa-miR-4524	CLIP-seq
MIRT993540	hsa-miR-4531	CLIP-seq
MIRT993541	hsa-miR-4639-3p	CLIP-seq
MIRT993542	hsa-miR-4676-3p	CLIP-seq
MIRT993478	hsa-miR-4679	CLIP-seq
MIRT993480	hsa-miR-4693-5p	CLIP-seq
MIRT993481	hsa-miR-4697-3p	CLIP-seq
MIRT993543	hsa-miR-4704-3p	CLIP-seq
MIRT993544	hsa-miR-4709-3p	CLIP-seq
MIRT993545	hsa-miR-4709-5p	CLIP-seq
MIRT993546	hsa-miR-4712-5p	CLIP-seq
MIRT993547	hsa-miR-4723-3p	CLIP-seq
MIRT993548	hsa-miR-4729	CLIP-seq
MIRT993549	hsa-miR-4738-3p	CLIP-seq
MIRT993550	hsa-miR-4758-3p	CLIP-seq
MIRT993551	hsa-miR-4766-5p	CLIP-seq
MIRT993552	hsa-miR-4775	CLIP-seq
MIRT993553	hsa-miR-4786-3p	CLIP-seq
MIRT993554	hsa-miR-4793-5p	CLIP-seq
MIRT993555	hsa-miR-4795-3p	CLIP-seq
MIRT993482	hsa-miR-489	CLIP-seq
MIRT993556	hsa-miR-497	CLIP-seq
MIRT993557	hsa-miR-503	CLIP-seq
MIRT993558	hsa-miR-507	CLIP-seq
MIRT993559	hsa-miR-513a-5p	CLIP-seq
MIRT993560	hsa-miR-548ah	CLIP-seq
MIRT993484	hsa-miR-548s	CLIP-seq
MIRT993561	hsa-miR-548t	CLIP-seq
MIRT993562	hsa-miR-557	CLIP-seq
MIRT993563	hsa-miR-571	CLIP-seq
MIRT993564	hsa-miR-577	CLIP-seq
MIRT993565	hsa-miR-579	CLIP-seq
MIRT993566	hsa-miR-584	CLIP-seq
MIRT993567	hsa-miR-589	CLIP-seq
MIRT993568	hsa-miR-603	CLIP-seq
MIRT993569	hsa-miR-620	CLIP-seq
MIRT993570	hsa-miR-634	CLIP-seq
MIRT993571	hsa-miR-646	CLIP-seq
MIRT993572	hsa-miR-656	CLIP-seq
MIRT993573	hsa-miR-671-5p	CLIP-seq
MIRT993574	hsa-miR-760	CLIP-seq
MIRT993575	hsa-miR-767-5p	CLIP-seq
MIRT993485	hsa-miR-892a	CLIP-seq
MIRT993576	hsa-miR-92a	CLIP-seq
MIRT993577	hsa-miR-92b	CLIP-seq
MIRT993578	hsa-miR-935	CLIP-seq
MIRT993579	hsa-miR-943	CLIP-seq
MIRT993463	hsa-miR-101	CLIP-seq
MIRT1994684	hsa-miR-132	CLIP-seq
MIRT993465	hsa-miR-144	CLIP-seq
MIRT1994685	hsa-miR-194	CLIP-seq
MIRT1994686	hsa-miR-212	CLIP-seq
MIRT993471	hsa-miR-223	CLIP-seq
MIRT993472	hsa-miR-3187-3p	CLIP-seq
MIRT993473	hsa-miR-3192	CLIP-seq
MIRT993532	hsa-miR-4434	CLIP-seq
MIRT993477	hsa-miR-4435	CLIP-seq
MIRT1994687	hsa-miR-4446-5p	CLIP-seq
MIRT993534	hsa-miR-4470	CLIP-seq
MIRT1994688	hsa-miR-4501	CLIP-seq
MIRT993537	hsa-miR-4516	CLIP-seq
MIRT993540	hsa-miR-4531	CLIP-seq
MIRT993481	hsa-miR-4697-3p	CLIP-seq
MIRT1994689	hsa-miR-4715-3p	CLIP-seq
MIRT993558	hsa-miR-507	CLIP-seq
MIRT1994690	hsa-miR-548a-3p	CLIP-seq
MIRT1994691	hsa-miR-548e	CLIP-seq
MIRT1994692	hsa-miR-548f	CLIP-seq
MIRT1994693	hsa-miR-548g	CLIP-seq
MIRT993484	hsa-miR-548s	CLIP-seq
MIRT993562	hsa-miR-557	CLIP-seq
MIRT993463	hsa-miR-101	CLIP-seq
MIRT993486	hsa-miR-103a	CLIP-seq
MIRT2228777	hsa-miR-1183	CLIP-seq
MIRT993487	hsa-miR-1226	CLIP-seq
MIRT993489	hsa-miR-1267	CLIP-seq
MIRT2228778	hsa-miR-129-5p	CLIP-seq
MIRT993495	hsa-miR-137	CLIP-seq
MIRT993465	hsa-miR-144	CLIP-seq
MIRT993498	hsa-miR-15a	CLIP-seq
MIRT993499	hsa-miR-15b	CLIP-seq
MIRT993500	hsa-miR-16	CLIP-seq
MIRT2228779	hsa-miR-182	CLIP-seq
MIRT993502	hsa-miR-195	CLIP-seq
MIRT993467	hsa-miR-200b	CLIP-seq
MIRT993468	hsa-miR-200c	CLIP-seq
MIRT993503	hsa-miR-219-1-3p	CLIP-seq
MIRT2228780	hsa-miR-22	CLIP-seq
MIRT993471	hsa-miR-223	CLIP-seq
MIRT993504	hsa-miR-25	CLIP-seq
MIRT993507	hsa-miR-29a	CLIP-seq
MIRT993508	hsa-miR-29b	CLIP-seq
MIRT993509	hsa-miR-29c	CLIP-seq
MIRT993514	hsa-miR-3145-3p	CLIP-seq
MIRT993515	hsa-miR-3183	CLIP-seq
MIRT993472	hsa-miR-3187-3p	CLIP-seq
MIRT993516	hsa-miR-3189-5p	CLIP-seq
MIRT993473	hsa-miR-3192	CLIP-seq
MIRT2228781	hsa-miR-3199	CLIP-seq
MIRT993517	hsa-miR-32	CLIP-seq
MIRT2228782	hsa-miR-320a	CLIP-seq
MIRT2228783	hsa-miR-320b	CLIP-seq
MIRT2228784	hsa-miR-320c	CLIP-seq
MIRT2228785	hsa-miR-320d	CLIP-seq
MIRT993519	hsa-miR-338-3p	CLIP-seq
MIRT2228786	hsa-miR-3607-3p	CLIP-seq
MIRT993520	hsa-miR-3609	CLIP-seq
MIRT993521	hsa-miR-363	CLIP-seq
MIRT993522	hsa-miR-3655	CLIP-seq
MIRT993523	hsa-miR-367	CLIP-seq
MIRT993524	hsa-miR-3682-5p	CLIP-seq
MIRT993474	hsa-miR-3975	CLIP-seq
MIRT993526	hsa-miR-424	CLIP-seq
MIRT993528	hsa-miR-4264	CLIP-seq
MIRT993475	hsa-miR-429	CLIP-seq
MIRT993529	hsa-miR-4290	CLIP-seq
MIRT2228787	hsa-miR-4314	CLIP-seq
MIRT993476	hsa-miR-4318	CLIP-seq
MIRT993531	hsa-miR-4423-5p	CLIP-seq
MIRT2228788	hsa-miR-4429	CLIP-seq
MIRT993477	hsa-miR-4435	CLIP-seq
MIRT2228789	hsa-miR-4436a	CLIP-seq
MIRT1994687	hsa-miR-4446-5p	CLIP-seq
MIRT993534	hsa-miR-4470	CLIP-seq
MIRT993535	hsa-miR-4474-3p	CLIP-seq
MIRT2228790	hsa-miR-450b-5p	CLIP-seq
MIRT993539	hsa-miR-4524	CLIP-seq
MIRT2228791	hsa-miR-4646-5p	CLIP-seq
MIRT993478	hsa-miR-4679	CLIP-seq
MIRT993480	hsa-miR-4693-5p	CLIP-seq
MIRT993481	hsa-miR-4697-3p	CLIP-seq
MIRT993543	hsa-miR-4704-3p	CLIP-seq
MIRT993544	hsa-miR-4709-3p	CLIP-seq
MIRT993546	hsa-miR-4712-5p	CLIP-seq
MIRT993547	hsa-miR-4723-3p	CLIP-seq
MIRT993548	hsa-miR-4729	CLIP-seq
MIRT2228792	hsa-miR-4742-5p	CLIP-seq
MIRT993550	hsa-miR-4758-3p	CLIP-seq
MIRT993552	hsa-miR-4775	CLIP-seq
MIRT993555	hsa-miR-4795-3p	CLIP-seq
MIRT993482	hsa-miR-489	CLIP-seq
MIRT993556	hsa-miR-497	CLIP-seq
MIRT993557	hsa-miR-503	CLIP-seq
MIRT2228793	hsa-miR-518a-5p	CLIP-seq
MIRT2228794	hsa-miR-527	CLIP-seq
MIRT2228795	hsa-miR-548ad	CLIP-seq
MIRT993560	hsa-miR-548ah	CLIP-seq
MIRT993484	hsa-miR-548s	CLIP-seq
MIRT993561	hsa-miR-548t	CLIP-seq
MIRT993563	hsa-miR-571	CLIP-seq
MIRT993564	hsa-miR-577	CLIP-seq
MIRT993565	hsa-miR-579	CLIP-seq
MIRT993566	hsa-miR-584	CLIP-seq
MIRT2228796	hsa-miR-605	CLIP-seq
MIRT2228797	hsa-miR-622	CLIP-seq
MIRT993570	hsa-miR-634	CLIP-seq
MIRT993571	hsa-miR-646	CLIP-seq
MIRT993572	hsa-miR-656	CLIP-seq
MIRT993574	hsa-miR-760	CLIP-seq
MIRT993485	hsa-miR-892a	CLIP-seq
MIRT2228798	hsa-miR-922	CLIP-seq
MIRT993576	hsa-miR-92a	CLIP-seq
MIRT993577	hsa-miR-92b	CLIP-seq
MIRT993578	hsa-miR-935	CLIP-seq
MIRT2387955	hsa-miR-140-3p	CLIP-seq
MIRT2387956	hsa-miR-197	CLIP-seq
MIRT993463	hsa-miR-101	CLIP-seq
MIRT993465	hsa-miR-144	CLIP-seq
MIRT993473	hsa-miR-3192	CLIP-seq
MIRT2532339	hsa-miR-1	CLIP-seq
MIRT993463	hsa-miR-101	CLIP-seq
MIRT993486	hsa-miR-103a	CLIP-seq
MIRT993488	hsa-miR-1236	CLIP-seq
MIRT993464	hsa-miR-1238	CLIP-seq
MIRT2532340	hsa-miR-1264	CLIP-seq
MIRT993490	hsa-miR-1270	CLIP-seq
MIRT993491	hsa-miR-128	CLIP-seq
MIRT2228778	hsa-miR-129-5p	CLIP-seq
MIRT993465	hsa-miR-144	CLIP-seq
MIRT993498	hsa-miR-15a	CLIP-seq
MIRT993499	hsa-miR-15b	CLIP-seq
MIRT993500	hsa-miR-16	CLIP-seq
MIRT993501	hsa-miR-1827	CLIP-seq
MIRT993466	hsa-miR-188-5p	CLIP-seq
MIRT993502	hsa-miR-195	CLIP-seq
MIRT993467	hsa-miR-200b	CLIP-seq
MIRT993468	hsa-miR-200c	CLIP-seq
MIRT993469	hsa-miR-204	CLIP-seq
MIRT2532341	hsa-miR-206	CLIP-seq
MIRT993470	hsa-miR-211	CLIP-seq
MIRT2532342	hsa-miR-2113	CLIP-seq
MIRT993503	hsa-miR-219-1-3p	CLIP-seq
MIRT2532343	hsa-miR-219-5p	CLIP-seq
MIRT2532344	hsa-miR-2278	CLIP-seq
MIRT2532345	hsa-miR-24	CLIP-seq
MIRT993505	hsa-miR-27a	CLIP-seq
MIRT993506	hsa-miR-27b	CLIP-seq
MIRT993507	hsa-miR-29a	CLIP-seq
MIRT993508	hsa-miR-29b	CLIP-seq
MIRT993509	hsa-miR-29c	CLIP-seq
MIRT2532346	hsa-miR-3064-3p	CLIP-seq
MIRT993510	hsa-miR-3121-3p	CLIP-seq
MIRT2532347	hsa-miR-3129-3p	CLIP-seq
MIRT993512	hsa-miR-3136-5p	CLIP-seq
MIRT2532348	hsa-miR-3140-3p	CLIP-seq
MIRT2532349	hsa-miR-3173-3p	CLIP-seq
MIRT2532350	hsa-miR-3185	CLIP-seq
MIRT993472	hsa-miR-3187-3p	CLIP-seq
MIRT993473	hsa-miR-3192	CLIP-seq
MIRT2228781	hsa-miR-3199	CLIP-seq
MIRT993518	hsa-miR-3200-5p	CLIP-seq
MIRT2532351	hsa-miR-33a	CLIP-seq
MIRT2532352	hsa-miR-33b	CLIP-seq
MIRT2532353	hsa-miR-3613-3p	CLIP-seq
MIRT2532354	hsa-miR-3673	CLIP-seq
MIRT993524	hsa-miR-3682-5p	CLIP-seq
MIRT993525	hsa-miR-3688-3p	CLIP-seq
MIRT2532355	hsa-miR-3688-5p	CLIP-seq
MIRT2532356	hsa-miR-3920	CLIP-seq
MIRT993474	hsa-miR-3975	CLIP-seq
MIRT993526	hsa-miR-424	CLIP-seq
MIRT2532357	hsa-miR-4276	CLIP-seq
MIRT2532358	hsa-miR-4282	CLIP-seq
MIRT2532359	hsa-miR-4284	CLIP-seq
MIRT993475	hsa-miR-429	CLIP-seq
MIRT2228787	hsa-miR-4314	CLIP-seq
MIRT993476	hsa-miR-4318	CLIP-seq
MIRT993530	hsa-miR-432	CLIP-seq
MIRT993532	hsa-miR-4434	CLIP-seq
MIRT993477	hsa-miR-4435	CLIP-seq
MIRT2228789	hsa-miR-4436a	CLIP-seq
MIRT993533	hsa-miR-4439	CLIP-seq
MIRT2532360	hsa-miR-4445	CLIP-seq
MIRT993534	hsa-miR-4470	CLIP-seq
MIRT993535	hsa-miR-4474-3p	CLIP-seq
MIRT2532361	hsa-miR-4494	CLIP-seq
MIRT993537	hsa-miR-4516	CLIP-seq
MIRT993538	hsa-miR-452	CLIP-seq
MIRT993539	hsa-miR-4524	CLIP-seq
MIRT993540	hsa-miR-4531	CLIP-seq
MIRT993541	hsa-miR-4639-3p	CLIP-seq
MIRT2228791	hsa-miR-4646-5p	CLIP-seq
MIRT993542	hsa-miR-4676-3p	CLIP-seq
MIRT993478	hsa-miR-4679	CLIP-seq
MIRT993479	hsa-miR-4691-5p	CLIP-seq
MIRT993480	hsa-miR-4693-5p	CLIP-seq
MIRT993481	hsa-miR-4697-3p	CLIP-seq
MIRT993544	hsa-miR-4709-3p	CLIP-seq
MIRT993545	hsa-miR-4709-5p	CLIP-seq
MIRT1994689	hsa-miR-4715-3p	CLIP-seq
MIRT993548	hsa-miR-4729	CLIP-seq
MIRT993549	hsa-miR-4738-3p	CLIP-seq
MIRT2228792	hsa-miR-4742-5p	CLIP-seq
MIRT993551	hsa-miR-4766-5p	CLIP-seq
MIRT2532362	hsa-miR-4773	CLIP-seq
MIRT993552	hsa-miR-4775	CLIP-seq
MIRT2532363	hsa-miR-4782-3p	CLIP-seq
MIRT993555	hsa-miR-4795-3p	CLIP-seq
MIRT2532364	hsa-miR-495	CLIP-seq
MIRT993556	hsa-miR-497	CLIP-seq
MIRT2532365	hsa-miR-499a-5p	CLIP-seq
MIRT993557	hsa-miR-503	CLIP-seq
MIRT993558	hsa-miR-507	CLIP-seq
MIRT2532366	hsa-miR-508-3p	CLIP-seq
MIRT993559	hsa-miR-513a-5p	CLIP-seq
MIRT2532367	hsa-miR-515-5p	CLIP-seq
MIRT2228795	hsa-miR-548ad	CLIP-seq
MIRT993483	hsa-miR-548m	CLIP-seq
MIRT993484	hsa-miR-548s	CLIP-seq
MIRT2532368	hsa-miR-549	CLIP-seq
MIRT993562	hsa-miR-557	CLIP-seq
MIRT2532369	hsa-miR-561	CLIP-seq
MIRT993563	hsa-miR-571	CLIP-seq
MIRT993564	hsa-miR-577	CLIP-seq
MIRT993565	hsa-miR-579	CLIP-seq
MIRT2532370	hsa-miR-586	CLIP-seq
MIRT2532371	hsa-miR-587	CLIP-seq
MIRT2532372	hsa-miR-599	CLIP-seq
MIRT993568	hsa-miR-603	CLIP-seq
MIRT2532373	hsa-miR-613	CLIP-seq
MIRT993569	hsa-miR-620	CLIP-seq
MIRT2228797	hsa-miR-622	CLIP-seq
MIRT993570	hsa-miR-634	CLIP-seq
MIRT993571	hsa-miR-646	CLIP-seq
MIRT993573	hsa-miR-671-5p	CLIP-seq
MIRT993574	hsa-miR-760	CLIP-seq
MIRT2532374	hsa-miR-877	CLIP-seq
MIRT993485	hsa-miR-892a	CLIP-seq
MIRT2228798	hsa-miR-922	CLIP-seq
MIRT993579	hsa-miR-943	CLIP-seq
MIRT993463	hsa-miR-101	CLIP-seq
MIRT993486	hsa-miR-103a	CLIP-seq
MIRT993488	hsa-miR-1236	CLIP-seq
MIRT993464	hsa-miR-1238	CLIP-seq
MIRT2532340	hsa-miR-1264	CLIP-seq
MIRT993490	hsa-miR-1270	CLIP-seq
MIRT993491	hsa-miR-128	CLIP-seq
MIRT993465	hsa-miR-144	CLIP-seq
MIRT993498	hsa-miR-15a	CLIP-seq
MIRT993499	hsa-miR-15b	CLIP-seq
MIRT993500	hsa-miR-16	CLIP-seq
MIRT993501	hsa-miR-1827	CLIP-seq
MIRT993466	hsa-miR-188-5p	CLIP-seq
MIRT993502	hsa-miR-195	CLIP-seq
MIRT993469	hsa-miR-204	CLIP-seq
MIRT993470	hsa-miR-211	CLIP-seq
MIRT993503	hsa-miR-219-1-3p	CLIP-seq
MIRT2532343	hsa-miR-219-5p	CLIP-seq
MIRT2532345	hsa-miR-24	CLIP-seq
MIRT993505	hsa-miR-27a	CLIP-seq
MIRT993506	hsa-miR-27b	CLIP-seq
MIRT2532346	hsa-miR-3064-3p	CLIP-seq
MIRT993510	hsa-miR-3121-3p	CLIP-seq
MIRT2532347	hsa-miR-3129-3p	CLIP-seq
MIRT993512	hsa-miR-3136-5p	CLIP-seq
MIRT2532348	hsa-miR-3140-3p	CLIP-seq
MIRT2532350	hsa-miR-3185	CLIP-seq
MIRT993472	hsa-miR-3187-3p	CLIP-seq
MIRT993473	hsa-miR-3192	CLIP-seq
MIRT2532351	hsa-miR-33a	CLIP-seq
MIRT2532352	hsa-miR-33b	CLIP-seq
MIRT993525	hsa-miR-3688-3p	CLIP-seq
MIRT2532355	hsa-miR-3688-5p	CLIP-seq
MIRT2532356	hsa-miR-3920	CLIP-seq
MIRT993474	hsa-miR-3975	CLIP-seq
MIRT993526	hsa-miR-424	CLIP-seq
MIRT2532357	hsa-miR-4276	CLIP-seq
MIRT2532358	hsa-miR-4282	CLIP-seq
MIRT2532359	hsa-miR-4284	CLIP-seq
MIRT993530	hsa-miR-432	CLIP-seq
MIRT993532	hsa-miR-4434	CLIP-seq
MIRT993477	hsa-miR-4435	CLIP-seq
MIRT2228789	hsa-miR-4436a	CLIP-seq
MIRT993533	hsa-miR-4439	CLIP-seq
MIRT2532360	hsa-miR-4445	CLIP-seq
MIRT993534	hsa-miR-4470	CLIP-seq
MIRT993535	hsa-miR-4474-3p	CLIP-seq
MIRT2532361	hsa-miR-4494	CLIP-seq
MIRT993537	hsa-miR-4516	CLIP-seq
MIRT993539	hsa-miR-4524	CLIP-seq
MIRT993540	hsa-miR-4531	CLIP-seq
MIRT993479	hsa-miR-4691-5p	CLIP-seq
MIRT993544	hsa-miR-4709-3p	CLIP-seq
MIRT993545	hsa-miR-4709-5p	CLIP-seq
MIRT1994689	hsa-miR-4715-3p	CLIP-seq
MIRT993548	hsa-miR-4729	CLIP-seq
MIRT993549	hsa-miR-4738-3p	CLIP-seq
MIRT2532363	hsa-miR-4782-3p	CLIP-seq
MIRT2532364	hsa-miR-495	CLIP-seq
MIRT993556	hsa-miR-497	CLIP-seq
MIRT2532365	hsa-miR-499a-5p	CLIP-seq
MIRT993557	hsa-miR-503	CLIP-seq
MIRT2532366	hsa-miR-508-3p	CLIP-seq
MIRT993559	hsa-miR-513a-5p	CLIP-seq
MIRT2228795	hsa-miR-548ad	CLIP-seq
MIRT993483	hsa-miR-548m	CLIP-seq
MIRT993484	hsa-miR-548s	CLIP-seq
MIRT2532368	hsa-miR-549	CLIP-seq
MIRT993563	hsa-miR-571	CLIP-seq
MIRT993565	hsa-miR-579	CLIP-seq
MIRT2532370	hsa-miR-586	CLIP-seq
MIRT2532371	hsa-miR-587	CLIP-seq
MIRT993569	hsa-miR-620	CLIP-seq
MIRT993571	hsa-miR-646	CLIP-seq
MIRT993573	hsa-miR-671-5p	CLIP-seq
MIRT993574	hsa-miR-760	CLIP-seq
MIRT2532374	hsa-miR-877	CLIP-seq
MIRT2228798	hsa-miR-922	CLIP-seq
MIRT993579	hsa-miR-943	CLIP-seq
MIRT993473	hsa-miR-3192	CLIP-seq

Show/Hide all(80)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IDA	25438055
GO:0001944	Process	Vasculature development	IEA
GO:0001944	Process	Vasculature development	TAS	21123947
GO:0005515	Function	Protein binding	IPI	15070733, 15103331, 17157259, 17314511, 17558397, 17873522, 17909182, 19111882, 19412162, 20596027, 20823234, 21145461, 21620836, 22307056, 22939624, 23022380, 23082202, 23108047, 23791182, 24000165, 24344117, 24412244, 25344755, 25775507, 25897075, 27229929, 27238018, 27458189, 278
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	17558397
GO:0005634	Component	Nucleus	IDA	28007894
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	17558397
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IDA	17558397, 28007894
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	23858059, 28007894
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	NAS	25897075
GO:0005829	Component	Cytosol	TAS
GO:0006281	Process	DNA repair	IEA
GO:0006974	Process	DNA damage response	IDA	17873522
GO:0006974	Process	DNA damage response	IEA
GO:0007062	Process	Sister chromatid cohesion	IMP	15917200
GO:0007346	Process	Regulation of mitotic cell cycle	IDA	19160488
GO:0010629	Process	Negative regulation of gene expression	IGI	23823476
GO:0010629	Process	Negative regulation of gene expression	IMP	23823476
GO:0010868	Process	Negative regulation of triglyceride biosynthetic process	ISS
GO:0010883	Process	Regulation of lipid storage	ISS
GO:0010992	Process	Ubiquitin recycling	IBA
GO:0016567	Process	Protein ubiquitination	IDA	12354302
GO:0016567	Process	Protein ubiquitination	IDA	15103331
GO:0016567	Process	Protein ubiquitination	IEA
GO:0019005	Component	SCF ubiquitin ligase complex	IDA	12628165, 15103331, 17434132, 28007894
GO:0030332	Function	Cyclin binding	IDA	12628165
GO:0030332	Function	Cyclin binding	IPI	17434132
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	12628165
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IDA	15103331, 17434132
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IEA
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IMP	28007894
GO:0031398	Process	Positive regulation of protein ubiquitination	IDA	12628165
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	12628165
GO:0031647	Process	Regulation of protein stability	IEA
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	34102342
GO:0032880	Process	Regulation of protein localization	ISS
GO:0032991	Component	Protein-containing complex	IDA	17873522
GO:0034644	Process	Cellular response to UV	IDA	17873522
GO:0042752	Process	Regulation of circadian rhythm	IEA
GO:0042752	Process	Regulation of circadian rhythm	IMP	27238018
GO:0042802	Function	Identical protein binding	IPI	21620836, 23791182, 35512704
GO:0043130	Function	Ubiquitin binding	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	20389280
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	15103331
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	25897075, 35395208
GO:0045742	Process	Positive regulation of epidermal growth factor receptor signaling pathway	ISS
GO:0045746	Process	Negative regulation of Notch signaling pathway	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	19160488
GO:0048511	Process	Rhythmic process	IEA
GO:0050816	Function	Phosphothreonine residue binding	IDA	17434132
GO:0050821	Process	Protein stabilization	ISS
GO:0055088	Process	Lipid homeostasis	ISS
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	ISS
GO:0097027	Function	Ubiquitin-protein transferase activator activity	IDA	12628165
GO:1901524	Process	Regulation of mitophagy	IMP	24912190
GO:1901800	Process	Positive regulation of proteasomal protein catabolic process	IDA	23858059
GO:1901800	Process	Positive regulation of proteasomal protein catabolic process	IEA
GO:1902806	Process	Regulation of cell cycle G1/S phase transition	TAS	12628165
GO:1903378	Process	Positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway	IDA	23858059
GO:1903378	Process	Positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway	IEA
GO:1903955	Process	Positive regulation of protein targeting to mitochondrion	IMP	24912190
GO:1990452	Component	Parkin-FBXW7-Cul1 ubiquitin ligase complex	IPI	12628165
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IDA	15150404, 34741373
GO:2000059	Process	Negative regulation of ubiquitin-dependent protein catabolic process	IDA	24424410
GO:2000060	Process	Positive regulation of ubiquitin-dependent protein catabolic process	IEA
GO:2000060	Process	Positive regulation of ubiquitin-dependent protein catabolic process	IMP	27238018
GO:2000060	Process	Positive regulation of ubiquitin-dependent protein catabolic process	ISS
GO:2000346	Process	Negative regulation of hepatocyte proliferation	ISS
GO:2000639	Process	Negative regulation of SREBP signaling pathway	ISS
GO:2001205	Process	Negative regulation of osteoclast development	IEA
GO:2001205	Process	Negative regulation of osteoclast development	IMP	29149593

MIM	HGNC	e!Ensembl
606278	16712	ENSG00000109670

Protein

UniProt ID

Q969H0

Protein name

F-box/WD repeat-containing protein 7 (Archipelago homolog) (hAgo) (F-box and WD-40 domain-containing protein 7) (F-box protein FBX30) (SEL-10) (hCdc4)

Protein function

Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed:17434132, PubMed:22748924, PubMed:26976582

PDB

2OVP , 2OVQ , 2OVR , 5IBK , 5V4B , 7T1Y , 7T1Z

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12937	F-box-like	281 → 327	F-box-like	Domain
PF00400	WD40	370 → 407	WD domain, G-beta repeat	Repeat
PF00400	WD40	411 → 447	WD domain, G-beta repeat	Repeat
PF00400	WD40	451 → 487	WD domain, G-beta repeat	Repeat
PF00400	WD40	491 → 527	WD domain, G-beta repeat	Repeat
PF00400	WD40	531 → 567	WD domain, G-beta repeat	Repeat
PF00400	WD40	571 → 607	WD domain, G-beta repeat	Repeat
PF00400	WD40	611 → 650	WD domain, G-beta repeat	Repeat

Tissue specificity

TISSUE SPECIFICITY: [Isoform 1]: Widely expressed. {ECO:0000269|PubMed:12354302}.; TISSUE SPECIFICITY: [Isoform 3]: Expressed in brain. {ECO:0000269|PubMed:12354302}.

Sequence

MNQELLSVGSKRRRTGGSLRGNPSSSQVDEEQMNRVVEEEQQQQLRQQEEEHTARNGEVV
GVEPRPGGQNDSQQGQLEENNNRFISVDEDSSGNQEEQEEDEEHAGEQDEEDEEEEEMDQ
ESDDFDQSDDSSREDEHTHTNSVTNSSSIVDLPVHQLSSPFYTKTTKMKRKLDHGSEVRS
FSLGKKPCKVSEYTSTTGLVPCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKM
FQSWSGPEKLLALDELIDSCEPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKD
LLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHR
IDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGH
TGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRD
ATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGH
TNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNAD
STVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNL
VTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK

Sequence length

707

Interactions

View interactions

	KEGG		Reactome
	Ubiquitin mediated proteolysis		Constitutive Signaling by NOTCH1 PEST Domain Mutants Loss of Function of FBXW7 in Cancer and NOTCH1 Signaling Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants Neddylation Antigen processing: Ubiquitination & Proteasome degradation

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Diabetes	Type 2 diabetes	N/A	N/A	GWAS

Show/Hide Text Mining Associations (131)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma	Associate	26317919, 26536055, 29219616
Adenocarcinoma Mucinous	Associate	29793804
Adenocarcinoma of Lung	Associate	24360397, 37393311
Adenoma	Associate	25860929, 27221540
Adenomatous Polyposis Coli	Associate	37164664
Adenomyosis	Associate	36708516
Aneuploidy	Associate	26354767
Ataxia Telangiectasia	Associate	17646409, 27602765
Beckwith Wiedemann Syndrome	Associate	35507738
Breast Neoplasms	Associate	15318934, 21122106, 21134077, 22538770, 25669969, 25927147, 26482194, 27409838, 30365154, 31351478, 31704974, 34181803, 34953047, 35132755, 35508987
Breast Neoplasms	Inhibit	23166673, 37902422
Cap Myopathy	Associate	29453410
Carcinogenesis	Associate	15150404, 16357515, 20388706, 20448329, 22608923, 25860929, 27232758, 27998038, 28760857, 28980868, 29735700, 29963728, 35225231
Carcinogenesis	Inhibit	16863506, 35840806
Carcinoma Endometrioid	Associate	26647729
Carcinoma Hepatocellular	Associate	24586741, 26602384, 28716020, 39473409
Carcinoma Large Cell	Associate	26317919
Carcinoma Merkel Cell	Associate	23954152, 26981779, 30689667, 34593967, 35336880
Carcinoma Non Small Cell Lung	Associate	24165483, 24377525, 26464659, 28507201, 28949784, 32945381, 35840806
Carcinoma Non Small Cell Lung	Inhibit	30094882
Carcinoma Ovarian Epithelial	Associate	27486687, 37247277
Carcinoma Renal Cell	Associate	27144525, 28718916, 35231161
Carcinoma Renal Cell	Inhibit	29097832
Carcinoma Small Cell	Associate	25512615
Carcinoma Squamous Cell	Associate	24390348, 26030731, 26479420, 28099906, 28177435, 28581676, 29980281, 33197299, 34851968, 36225179, 36869079
Carcinosarcoma	Associate	28940304, 30194005, 32114514
Cholangiocarcinoma	Associate	25536104, 27593557, 30302867
Chromosomal Instability	Associate	17457043, 18299561, 28760857, 28980868
Colonic Neoplasms	Associate	28424412, 31876604
Colorectal Neoplasms	Associate	14999283, 17457043, 22285861, 23558291, 24475022, 24586741, 25450649, 25617745, 25855785, 25860929, 26097998, 26134512, 26375816, 26797410, 27146902 View all (32 more)
Colorectal Neoplasms	Inhibit	29910683
Congenital Disorder Of Glycosylation Type Im	Associate	29290541
Coxa Magna	Associate	35118903
Death	Associate	21122106, 33580200
Depressive Disorder	Associate	28949784
Diabetes Mellitus	Associate	34372947
Diabetes Mellitus Type 2	Associate	34372947
Diabetic Nephropathies	Associate	31119177
Drug Related Side Effects and Adverse Reactions	Stimulate	29427543
Dyslipidemias	Associate	36570009
Embryo Loss	Associate	15498494
Endometrial Neoplasms	Associate	23104009, 29963728, 32239181, 32248654, 33536036, 33754208, 33872388, 36454788, 37587857, 38536067
Ependymoma	Associate	33247464
Esophageal Neoplasms	Associate	22108521, 27107065, 29127303, 30115035
Esophageal Squamous Cell Carcinoma	Associate	22108521, 26857264, 26873401, 27259248, 27734031, 36991467
Fanconi Anemia	Associate	30789902
Fibrocystic Breast Disease	Associate	33382535
Fibrosis	Associate	31119177
Glioblastoma	Associate	29427543, 34278448
Glioblastoma	Inhibit	33247464
Glioma	Associate	18931460, 29427543, 31740732
Glioma	Inhibit	31519156, 32365279, 33247464
Glomerulosclerosis Focal Segmental	Associate	26482194
Glomus vagale tumors	Associate	22405651
Glucosephosphate Dehydrogenase Deficiency	Associate	29963728
Hemangioma capillary infantile	Associate	36181115
Hematologic Neoplasms	Associate	36322817
Hepatoblastoma	Associate	35507738
Hereditary Breast and Ovarian Cancer Syndrome	Associate	16357515
Hodgkin Disease	Associate	26482194
Huntington Disease	Associate	17646408
Hypoxia	Associate	21964756, 26467103
Hypoxia	Stimulate	36240645
Infections	Associate	33580200
Inflammation	Associate	31119177, 36322817
Inflammatory Bowel Diseases	Associate	32697969
Intestinal Diseases	Associate	32198650
Kidney Neoplasms	Inhibit	23166673, 29097832
Laryngitis	Associate	29700339
Leukemia	Associate	17646408, 17646409
Leukemia Biphenotypic Acute	Associate	36322817, 36395886
Leukemia Lymphocytic Chronic B Cell	Associate	27060156, 27633522, 28399885, 30038380, 30510140, 33054084, 36947610, 37955424
Leukemia Myeloid Acute	Associate	31638252
Leukemia Plasma Cell	Associate	35770320
Leukemia T Cell	Associate	17646408
Liver Failure	Associate	24586741
Lung Neoplasms	Associate	23108047, 28949784
Lymphatic Metastasis	Associate	24053468
Lymphoma	Associate	15150404
Lymphoma Large B Cell Diffuse	Associate	28069035
Lymphoma Non Hodgkin	Associate	19245433
Lymphoma T Cell	Associate	36000950
Lymphoproliferative Disorders	Associate	31655559
Melanocytic nevus syndrome congenital	Associate	34912899
Melanoma	Inhibit	23381582, 24838835, 29665239
Melanoma	Associate	25784655, 31843895, 39213172
Mesangial sclerosis diffuse	Associate	31119177
Mohr Tranebjaerg syndrome	Associate	25888377
Mouth Neoplasms	Associate	29037125
Myopathies Structural Congenital	Associate	29700339
Nasopharyngeal Carcinoma	Associate	25586348, 28581676
Neoplasm Metastasis	Associate	22144179, 25066378, 27609830, 27756406, 32329846, 34281583, 34953047
Neoplasm Metastasis	Inhibit	32365279, 39473409
Neoplasms	Associate	15150404, 15498494, 16210249, 16863506, 21134077, 21220517, 22323043, 22923510, 23108047, 23382697, 23558291, 23774303, 24265759, 24360397, 24671188 View all (43 more)
Neoplasms	Inhibit	15498494, 17189384, 17646408, 17909182, 18931460, 19679664, 20388706, 20448329, 21122106, 21620836, 22108521, 22608923, 23166673, 23381582, 23567558 View all (54 more)
Neoplasms Cystic Mucinous and Serous	Associate	22923510, 23104009, 23774303, 32248654
Neoplasms Cystic Mucinous and Serous	Inhibit	27486687
Neoplasms Glandular and Epithelial	Associate	29135520
Nerve Degeneration	Inhibit	32572904
Neuroectodermal Tumors Primitive	Associate	26482194
Neuroendocrine Tumors	Associate	37047300
Obesity	Associate	36291149
Osteoarthritis	Associate	32572904
Osteoporosis	Associate	30809532
Ovarian Neoplasms	Associate	23774303, 24586741, 28734796, 29793804, 35965327, 36982928, 37247277
Ovarian Neoplasms	Inhibit	27486687
Pancreatic Neoplasms	Associate	25638153, 28099906, 28242758, 28765935, 33271455
Pancreatic Neoplasms	Inhibit	34117747
Peritonitis	Associate	32166754
Polyps	Associate	27609830
Precancerous Conditions	Associate	32198650
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	19109228, 28245838, 32164600, 36934104
Precursor Cell Lymphoblastic Leukemia Lymphoma	Inhibit	26644537
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	17646408, 17646409, 19109228, 19245433, 19340001, 19635999, 20683149, 20944675, 21835957, 22675565, 25595890, 25966987, 26205622, 27602765, 29051182, 30387229, 32164600, 33436855 View all (3 more)
Prostatic Neoplasms	Associate	16357515, 23166673
Pseudomyxoma Peritonei	Associate	35255903
Rectal Neoplasms	Associate	26134512, 34647903, 36142267
Rhabdoid Tumor	Associate	30885698
Sinonasal undifferentiated carcinoma	Associate	23633104
Squamous Cell Carcinoma of Head and Neck	Associate	21798897, 24586741, 27323410, 29053175, 32329846, 32892208, 36522371
Squamous Cell Carcinoma of Head and Neck	Inhibit	29072128, 30883339
Stomach Neoplasms	Associate	20448329, 24053468, 25888377, 26499948, 26857264, 27167197, 28464881, 28522256, 30177679, 35280682
Testicular Germ Cell Tumor	Associate	28000896
Thyroid cancer follicular	Associate	31248021
Thyroid Neoplasms	Associate	32737449
Triple Negative Breast Neoplasms	Associate	22538770
Tuberculosis Pulmonary	Associate	35419455
Urinary Bladder Neoplasms	Associate	23166673
Uterine Cervical Neoplasms	Associate	24390348, 26155992, 32951893
Uterine Cervical Neoplasms	Inhibit	35094292
Wilms Tumor	Associate	20332316, 26482194, 30885698, 37019617

FBXW7 (F-box and WD repeat domain containing 7)