Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
55244
Gene name Gene Name - the full gene name approved by the HGNC.
Solute carrier family 47 member 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SLC47A1
Synonyms (NCBI Gene) Gene synonyms aliases
MATE1
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17p11.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is located within the Smith-Magenis syndrome region on chromosome 17. It encodes a protein of unknown function. [provided by RefSeq, Jul 2008]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT490619 hsa-miR-514a-5p PAR-CLIP 20371350
MIRT570111 hsa-miR-7160-3p PAR-CLIP 20371350
MIRT490618 hsa-miR-181d-3p PAR-CLIP 20371350
MIRT490617 hsa-miR-326 PAR-CLIP 20371350
MIRT490616 hsa-miR-330-5p PAR-CLIP 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005886 Component Plasma membrane IDA 28112518
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS
GO:0006855 Process Xenobiotic transmembrane transport IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609832 25588 ENSG00000142494
Protein
UniProt ID Q96FL8
Protein name Multidrug and toxin extrusion protein 1 (MATE-1) (hMATE-1) (Solute carrier family 47 member 1)
Protein function Multidrug efflux pump that functions as a H(+)/organic cation antiporter (PubMed:16330770, PubMed:17509534). Plays a physiological role in the excretion of cationic compounds including endogenous metabolites, drugs, toxins through the kidney and
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01554 MatE 44 204 MatE Family
PF01554 MatE 265 426 MatE Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. The highest expression is found in adrenal gland, and to a lower extent in liver, skeletal muscle and kidney. In testis, primarily localized throughout the adluminal compartment of the seminiferous tubules with expres
Sequence
MEAPEEPAPVRGGPEATLEVRGSRCLRLSAFREELRALLVLAGPAFLVQLMVFLISFISS
VFCGHLGKLELDAVTLAIAVINVTGVSVGFGLSSACDTLISQTYGSQNLKHVGVILQRSA
LVLLLCCFPCWALFLNTQHILLLFRQDPDVSRLTQTYVTIFIPALPATFLYMLQVKYLLN
QGIVLPQIVTGVAANLVNALANYL
FLHQLHLGVIGSALANLISQYTLALLLFLYILGKKL
HQATWGGWSLECLQDWASFLRLAIPSMLMLCMEWWAYEVGSFLSGILGMVELGAQSIVYE
LAIIVYMVPAGFSVAASVRVGNALGAGDMEQARKSSTVSLLITVLFAVAFSVLLLSCKDH
VGYIFTTDRDIINLVAQVVPIYAVSHLFEALACTSGGVLRGSGNQKVGAIVNTIGYYVVG
LPIGIA
LMFATTLGVMGLWSGIIICTVFQAVCFLGFIIQLNWKKACQQAQVHANLKVNNV
PRSGNSALPQDPLHPGCPENLEGILTNDVGKTGEPQSDQQMRQEEPLPEHPQDGAKLSRK
QLVLRRGLLLLGVFLILLVGILVRFYVRIQ
Sequence length 570
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Transport of bile salts and organic acids, metal ions and amine compounds
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Gout Gout N/A N/A GWAS
Intracranial Aneurysm Intracranial aneurysm N/A N/A GWAS
Kidney Disease Chronic kidney disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acute Kidney Injury Associate 28640195
Adenocarcinoma of Lung Associate 32939009
Arthritis Rheumatoid Associate 23284953
Carcinoma Hepatocellular Associate 29138286
Carcinoma Non Small Cell Lung Associate 27590272
Colorectal Neoplasms Associate 28992563, 32939009
Diabetes Mellitus Associate 23267855, 28947922
Diabetes Mellitus Type 2 Associate 27886175, 35905099, 36786075
Familial medullary thyroid carcinoma Associate 37175943
Hematologic Diseases Associate 27590272