Gene Gene information from NCBI Gene database.
Entrez ID 5521
Gene name Protein phosphatase 2 regulatory subunit Bbeta
Gene symbol PPP2R2B
Synonyms (NCBI Gene)
B55BETAPP2AB55BETAPP2ABBETAPP2APR55BPP2APR55BETAPR2AB55BETAPR2ABBETAPR2APR55BETAPR52BPR55-BETAPR55BETASCA12
Chromosome 5
Chromosome location 5q32
Summary The product of this gene belongs to the phosphatase 2 regulatory subunit B family. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heter
miRNA miRNA information provided by mirtarbase database.
28
miRTarBase ID miRNA Experiments Reference
MIRT044115 hsa-miR-30e-3p CLASH 23622248
MIRT454465 hsa-miR-548aa PAR-CLIP 23592263
MIRT454464 hsa-miR-548ap-3p PAR-CLIP 23592263
MIRT454463 hsa-miR-548t-3p PAR-CLIP 23592263
MIRT454461 hsa-miR-4779 PAR-CLIP 23592263
Transcription factors Transcription factors information provided by TRRUST V2 database.
3
Transcription factor Regulation Reference
CREB1 Activation 20533062
SP1 Activation 20533062
TFAP4 Repression 20533062
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15
GO ID Ontology Definition Evidence Reference
GO:0000159 Component Protein phosphatase type 2A complex IBA
GO:0000159 Component Protein phosphatase type 2A complex IEA
GO:0005515 Function Protein binding IPI 17274953, 19156129, 21075311, 25816751, 26496610, 32814053, 33961781
GO:0005737 Component Cytoplasm IEA
GO:0005739 Component Mitochondrion IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604325 9305 ENSG00000156475
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q00005
Protein name Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform (PP2A subunit B isoform B55-beta) (PP2A subunit B isoform PR55-beta) (PP2A subunit B isoform R2-beta) (PP2A subunit B isoform beta)
Protein function The B regulatory subunit might modulate substrate selectivity and catalytic activity, and might also direct the localization of the catalytic enzyme to a particular subcellular compartment. Within the PP2A holoenzyme complex, isoform 2 is requir
Family and domains
Tissue specificity TISSUE SPECIFICITY: Brain.
Sequence
MEEDIDTRKINNSFLRDHSYATEADIISTVEFNHTGELLATGDKGGRVVIFQREQESKNQ
VHRRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAYFLLSTNDKTVKLWKV
SERDKRPEGYNLKDEEGRLRDPATITTLRVPVLRPMDLMVEATPRRVFANAHTYHINSIS
VNSDYETYMSADDLRINLWNFEITNQSFNIVDIKPANMEELTEVITAAEFHPHHCNTFVY
SSSKGTIRLCDMRASALCDRHTKFFEEPEDPSNRSFFSEIISSISDVKFSHSGRYIMTRD
YLTVKVWDLNMENRPIETYQVHDYLRSKLCSLYENDCIFDKFECVWNGSDSVIMTGSYNN
FFRMFDRNTKRDVTLEASRENSKPRAILKPRKVCVGGKRRKDEISVDSLDFSKKILHTAW
HPSENIIAVAATNNLYIFQDKVN
Sequence length 443
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  mRNA surveillance pathway
Sphingolipid signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Adrenergic signaling in cardiomyocytes
Hippo signaling pathway
Tight junction
T cell receptor signaling pathway
Dopaminergic synapse
Chagas disease
Hepatitis C
Human papillomavirus infection
 
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
17
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Clear cell carcinoma of kidney Conflicting classifications of pathogenicity rs150981315 RCV005897340
Global developmental delay Uncertain significance rs2482678339 RCV002292451
Neurodevelopmental disorder Uncertain significance rs2151016852 RCV001771833
PPP2R2B-related disorder Likely benign; Conflicting classifications of pathogenicity; Benign; Uncertain significance rs143485788, rs140556908, rs10591869, rs17524553, rs562613082, rs771068110, rs199878645, rs1064796487 RCV004548197
RCV004548262
RCV004553108
RCV004554573
RCV004548938
RCV004550946
RCV004554558
RCV004550841
RCV004552825
RCV001249300
RCV004554492
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Attention Deficit Disorder with Hyperactivity Associate 27754487
Autistic Disorder Associate 36199823
Autoimmune Diseases of the Nervous System Associate 31335320
Breast Neoplasms Associate 20056007, 20669227, 23034890, 24093668
Carcinoma Associate 31742892
Carcinoma Ductal Associate 20056007
Carcinoma Intraductal Noninfiltrating Associate 20056007
Cardiomyopathy Dilated Associate 33407844
Coronary Artery Disease Associate 22369142
COVID 19 Associate 36649279