Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55182
Gene name	Ring finger protein 220
Gene symbol	RNF220
Synonyms (NCBI Gene)	C1orf164HLD23
Chromosome	1
Chromosome location	1p34.1

207

Show/Hide all (207)

miRTarBase ID	miRNA	Experiments	Reference
MIRT048901	hsa-miR-93-5p	CLASH	23622248
MIRT138278	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT138284	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT138279	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT138280	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT138286	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT1312327	hsa-miR-105	CLIP-seq
MIRT1312328	hsa-miR-1208	CLIP-seq
MIRT1312329	hsa-miR-1252	CLIP-seq
MIRT1312330	hsa-miR-140-3p	CLIP-seq
MIRT1312331	hsa-miR-196a	CLIP-seq
MIRT1312332	hsa-miR-196b	CLIP-seq
MIRT1312333	hsa-miR-214	CLIP-seq
MIRT1312334	hsa-miR-299-5p	CLIP-seq
MIRT1312335	hsa-miR-30a	CLIP-seq
MIRT1312336	hsa-miR-30b	CLIP-seq
MIRT1312337	hsa-miR-30c	CLIP-seq
MIRT1312338	hsa-miR-30d	CLIP-seq
MIRT1312339	hsa-miR-30e	CLIP-seq
MIRT1312340	hsa-miR-3149	CLIP-seq
MIRT1312341	hsa-miR-3153	CLIP-seq
MIRT1312342	hsa-miR-3202	CLIP-seq
MIRT1312343	hsa-miR-3619-5p	CLIP-seq
MIRT1312344	hsa-miR-3665	CLIP-seq
MIRT1312345	hsa-miR-371-3p	CLIP-seq
MIRT1312346	hsa-miR-371b-3p	CLIP-seq
MIRT1312347	hsa-miR-4300	CLIP-seq
MIRT1312348	hsa-miR-4475	CLIP-seq
MIRT1312349	hsa-miR-4488	CLIP-seq
MIRT1312350	hsa-miR-4505	CLIP-seq
MIRT1312351	hsa-miR-4530	CLIP-seq
MIRT1312352	hsa-miR-4646-3p	CLIP-seq
MIRT1312353	hsa-miR-4697-5p	CLIP-seq
MIRT1312354	hsa-miR-4703-3p	CLIP-seq
MIRT1312355	hsa-miR-4716-5p	CLIP-seq
MIRT1312356	hsa-miR-4717-3p	CLIP-seq
MIRT1312357	hsa-miR-4724-5p	CLIP-seq
MIRT1312358	hsa-miR-4729	CLIP-seq
MIRT1312359	hsa-miR-4731-3p	CLIP-seq
MIRT1312360	hsa-miR-4731-5p	CLIP-seq
MIRT1312361	hsa-miR-4736	CLIP-seq
MIRT1312362	hsa-miR-4747-5p	CLIP-seq
MIRT1312363	hsa-miR-4768-3p	CLIP-seq
MIRT1312364	hsa-miR-4789-5p	CLIP-seq
MIRT1312365	hsa-miR-4796-5p	CLIP-seq
MIRT1312366	hsa-miR-4801	CLIP-seq
MIRT1312367	hsa-miR-485-5p	CLIP-seq
MIRT1312368	hsa-miR-486-3p	CLIP-seq
MIRT1312369	hsa-miR-515-3p	CLIP-seq
MIRT1312370	hsa-miR-519e	CLIP-seq
MIRT1312371	hsa-miR-520d-5p	CLIP-seq
MIRT1312372	hsa-miR-524-5p	CLIP-seq
MIRT1312373	hsa-miR-550a	CLIP-seq
MIRT1312374	hsa-miR-568	CLIP-seq
MIRT1312375	hsa-miR-602	CLIP-seq
MIRT1312376	hsa-miR-637	CLIP-seq
MIRT1312377	hsa-miR-656	CLIP-seq
MIRT1312378	hsa-miR-761	CLIP-seq
MIRT1312379	hsa-miR-920	CLIP-seq
MIRT2092826	hsa-miR-1254	CLIP-seq
MIRT1312331	hsa-miR-196a	CLIP-seq
MIRT1312332	hsa-miR-196b	CLIP-seq
MIRT1312334	hsa-miR-299-5p	CLIP-seq
MIRT2092827	hsa-miR-3116	CLIP-seq
MIRT2092828	hsa-miR-3151	CLIP-seq
MIRT1312341	hsa-miR-3153	CLIP-seq
MIRT2092829	hsa-miR-3189-5p	CLIP-seq
MIRT1312344	hsa-miR-3665	CLIP-seq
MIRT1312345	hsa-miR-371-3p	CLIP-seq
MIRT1312346	hsa-miR-371b-3p	CLIP-seq
MIRT2092830	hsa-miR-4283	CLIP-seq
MIRT2092831	hsa-miR-4292	CLIP-seq
MIRT1312349	hsa-miR-4488	CLIP-seq
MIRT2092832	hsa-miR-4489	CLIP-seq
MIRT1312350	hsa-miR-4505	CLIP-seq
MIRT2092833	hsa-miR-4640-5p	CLIP-seq
MIRT1312353	hsa-miR-4697-5p	CLIP-seq
MIRT2092834	hsa-miR-4716-3p	CLIP-seq
MIRT2092835	hsa-miR-4723-5p	CLIP-seq
MIRT2092836	hsa-miR-4726-5p	CLIP-seq
MIRT2092837	hsa-miR-4728-5p	CLIP-seq
MIRT1312360	hsa-miR-4731-5p	CLIP-seq
MIRT1312361	hsa-miR-4736	CLIP-seq
MIRT2092838	hsa-miR-4758-3p	CLIP-seq
MIRT2092839	hsa-miR-485-3p	CLIP-seq
MIRT1312367	hsa-miR-485-5p	CLIP-seq
MIRT1312368	hsa-miR-486-3p	CLIP-seq
MIRT2092840	hsa-miR-487a	CLIP-seq
MIRT1312369	hsa-miR-515-3p	CLIP-seq
MIRT1312370	hsa-miR-519e	CLIP-seq
MIRT1312371	hsa-miR-520d-5p	CLIP-seq
MIRT1312372	hsa-miR-524-5p	CLIP-seq
MIRT1312373	hsa-miR-550a	CLIP-seq
MIRT1312376	hsa-miR-637	CLIP-seq
MIRT2092841	hsa-miR-661	CLIP-seq
MIRT2317436	hsa-miR-1228	CLIP-seq
MIRT2092826	hsa-miR-1254	CLIP-seq
MIRT2317437	hsa-miR-1287	CLIP-seq
MIRT1312330	hsa-miR-140-3p	CLIP-seq
MIRT2317438	hsa-miR-185	CLIP-seq
MIRT1312335	hsa-miR-30a	CLIP-seq
MIRT1312336	hsa-miR-30b	CLIP-seq
MIRT1312337	hsa-miR-30c	CLIP-seq
MIRT1312338	hsa-miR-30d	CLIP-seq
MIRT1312339	hsa-miR-30e	CLIP-seq
MIRT2092827	hsa-miR-3116	CLIP-seq
MIRT2317439	hsa-miR-3135b	CLIP-seq
MIRT2092828	hsa-miR-3151	CLIP-seq
MIRT1312342	hsa-miR-3202	CLIP-seq
MIRT2317440	hsa-miR-3612	CLIP-seq
MIRT1312344	hsa-miR-3665	CLIP-seq
MIRT2317441	hsa-miR-3918	CLIP-seq
MIRT2317442	hsa-miR-3977	CLIP-seq
MIRT2092830	hsa-miR-4283	CLIP-seq
MIRT2317443	hsa-miR-4306	CLIP-seq
MIRT2317444	hsa-miR-4443	CLIP-seq
MIRT1312348	hsa-miR-4475	CLIP-seq
MIRT1312349	hsa-miR-4488	CLIP-seq
MIRT2092832	hsa-miR-4489	CLIP-seq
MIRT1312350	hsa-miR-4505	CLIP-seq
MIRT2317445	hsa-miR-4644	CLIP-seq
MIRT1312352	hsa-miR-4646-3p	CLIP-seq
MIRT2317446	hsa-miR-4666-5p	CLIP-seq
MIRT1312353	hsa-miR-4697-5p	CLIP-seq
MIRT2092834	hsa-miR-4716-3p	CLIP-seq
MIRT1312356	hsa-miR-4717-3p	CLIP-seq
MIRT2092835	hsa-miR-4723-5p	CLIP-seq
MIRT1312357	hsa-miR-4724-5p	CLIP-seq
MIRT2092837	hsa-miR-4728-5p	CLIP-seq
MIRT1312358	hsa-miR-4729	CLIP-seq
MIRT1312359	hsa-miR-4731-3p	CLIP-seq
MIRT1312360	hsa-miR-4731-5p	CLIP-seq
MIRT1312361	hsa-miR-4736	CLIP-seq
MIRT1312362	hsa-miR-4747-5p	CLIP-seq
MIRT2317447	hsa-miR-4763-5p	CLIP-seq
MIRT1312363	hsa-miR-4768-3p	CLIP-seq
MIRT1312364	hsa-miR-4789-5p	CLIP-seq
MIRT1312365	hsa-miR-4796-5p	CLIP-seq
MIRT1312366	hsa-miR-4801	CLIP-seq
MIRT2092839	hsa-miR-485-3p	CLIP-seq
MIRT1312367	hsa-miR-485-5p	CLIP-seq
MIRT1312368	hsa-miR-486-3p	CLIP-seq
MIRT2092840	hsa-miR-487a	CLIP-seq
MIRT1312375	hsa-miR-602	CLIP-seq
MIRT1312376	hsa-miR-637	CLIP-seq
MIRT2317448	hsa-miR-650	CLIP-seq
MIRT1312377	hsa-miR-656	CLIP-seq
MIRT2092841	hsa-miR-661	CLIP-seq
MIRT1312335	hsa-miR-30a	CLIP-seq
MIRT1312336	hsa-miR-30b	CLIP-seq
MIRT1312337	hsa-miR-30c	CLIP-seq
MIRT1312338	hsa-miR-30d	CLIP-seq
MIRT1312339	hsa-miR-30e	CLIP-seq
MIRT1312341	hsa-miR-3153	CLIP-seq
MIRT1312365	hsa-miR-4796-5p	CLIP-seq
MIRT1312375	hsa-miR-602	CLIP-seq
MIRT2092837	hsa-miR-4728-5p	CLIP-seq
MIRT2317436	hsa-miR-1228	CLIP-seq
MIRT1312330	hsa-miR-140-3p	CLIP-seq
MIRT2613285	hsa-miR-1915	CLIP-seq
MIRT1312333	hsa-miR-214	CLIP-seq
MIRT2092828	hsa-miR-3151	CLIP-seq
MIRT1312341	hsa-miR-3153	CLIP-seq
MIRT2613286	hsa-miR-3175	CLIP-seq
MIRT1312343	hsa-miR-3619-5p	CLIP-seq
MIRT1312344	hsa-miR-3665	CLIP-seq
MIRT2613287	hsa-miR-3714	CLIP-seq
MIRT2317441	hsa-miR-3918	CLIP-seq
MIRT2092830	hsa-miR-4283	CLIP-seq
MIRT2613288	hsa-miR-4291	CLIP-seq
MIRT2092831	hsa-miR-4292	CLIP-seq
MIRT2613289	hsa-miR-4308	CLIP-seq
MIRT2613290	hsa-miR-4446-5p	CLIP-seq
MIRT1312349	hsa-miR-4488	CLIP-seq
MIRT2092832	hsa-miR-4489	CLIP-seq
MIRT1312350	hsa-miR-4505	CLIP-seq
MIRT2613291	hsa-miR-4646-5p	CLIP-seq
MIRT2613292	hsa-miR-4660	CLIP-seq
MIRT2613293	hsa-miR-4668-5p	CLIP-seq
MIRT1312353	hsa-miR-4697-5p	CLIP-seq
MIRT2613294	hsa-miR-4726-3p	CLIP-seq
MIRT2092837	hsa-miR-4728-5p	CLIP-seq
MIRT1312360	hsa-miR-4731-5p	CLIP-seq
MIRT1312361	hsa-miR-4736	CLIP-seq
MIRT2613295	hsa-miR-4755-5p	CLIP-seq
MIRT2613296	hsa-miR-4790-3p	CLIP-seq
MIRT1312367	hsa-miR-485-5p	CLIP-seq
MIRT1312368	hsa-miR-486-3p	CLIP-seq
MIRT2613297	hsa-miR-542-5p	CLIP-seq
MIRT2613298	hsa-miR-548an	CLIP-seq
MIRT1312376	hsa-miR-637	CLIP-seq
MIRT2613299	hsa-miR-670	CLIP-seq
MIRT1312378	hsa-miR-761	CLIP-seq
MIRT2613300	hsa-miR-922	CLIP-seq
MIRT2317436	hsa-miR-1228	CLIP-seq
MIRT1312330	hsa-miR-140-3p	CLIP-seq
MIRT1312341	hsa-miR-3153	CLIP-seq
MIRT2613287	hsa-miR-3714	CLIP-seq
MIRT2317441	hsa-miR-3918	CLIP-seq
MIRT2092831	hsa-miR-4292	CLIP-seq
MIRT2613289	hsa-miR-4308	CLIP-seq
MIRT2613290	hsa-miR-4446-5p	CLIP-seq
MIRT2613291	hsa-miR-4646-5p	CLIP-seq
MIRT2613293	hsa-miR-4668-5p	CLIP-seq
MIRT2613295	hsa-miR-4755-5p	CLIP-seq
MIRT2613298	hsa-miR-548an	CLIP-seq
MIRT2613299	hsa-miR-670	CLIP-seq

Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003358	Process	Noradrenergic neuron development	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	ISS
GO:0005515	Function	Protein binding	IPI	19549727, 25266658, 28514442, 30177510, 33961781, 33964137
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	IMP	33964137
GO:0005652	Component	Nuclear lamina	IMP	33964137
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0006513	Process	Protein monoubiquitination	IEA
GO:0006513	Process	Protein monoubiquitination	IEA
GO:0006513	Process	Protein monoubiquitination	IGI	32094113
GO:0008013	Function	Beta-catenin binding	IMP	33964137
GO:0008270	Function	Zinc ion binding	IEA
GO:0016567	Process	Protein ubiquitination	IBA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016567	Process	Protein ubiquitination	ISS
GO:0016740	Function	Transferase activity	IEA
GO:0021904	Process	Dorsal/ventral neural tube patterning	IEA
GO:0032991	Component	Protein-containing complex	IDA	30177510
GO:0046872	Function	Metal ion binding	IEA
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IGI	32094113
GO:0051865	Process	Protein autoubiquitination	IEA
GO:0051865	Process	Protein autoubiquitination	ISS
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IMP	25266658
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099149	Process	Regulation of postsynaptic neurotransmitter receptor internalization	IEA
GO:2000677	Process	Regulation of transcription regulatory region DNA binding	IGI	32094113

MIM	HGNC	e!Ensembl
616136	25552	ENSG00000187147

Q5VTB9

Protein name

E3 ubiquitin-protein ligase RNF220 (EC 2.3.2.27) (RING finger protein 220) (RING-type E3 ubiquitin transferase RNF220)

Protein function

E3 ubiquitin-protein ligase that promotes the ubiquitination and proteasomal degradation of SIN3B (By similarity). Independently of its E3 ligase activity, acts as a CTNNB1 stabilizer through USP7-mediated deubiquitination of CTNNB1 promoting Wn

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15926	RNF220	217 → 339	E3 ubiquitin-protein ligase RNF220	Family
PF15926	RNF220	336 → 444	E3 ubiquitin-protein ligase RNF220	Family
PF13923	zf-C3HC4_2	513 → 552		Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed. Abundant in brain and spinal cord, particularly in the cerebellum and cerebral cortex. In fetal tissues expressed in the cerebellum, spinal cord and cortex. {ECO:0000269|PubMed:33964137}.

Sequence

MDLHRAAFKMENSSYLPNPLASPALMVLASTAEASRDASIPCQQPRPFGVPVSVDKDVHI
PFTNGSYTFASMYHRQGGVPGTFANRDFPPSLLHLHPQFAPPNLDCTPISMLNHSGVGAF
RPFASTEDRESYQSAFTPAKRLKNCHDTESPHLRFSDADGKEYDFGTQLPSSSPGSLKVD
DTGKKIFAVSGLISDREASSSPEDRNDRCKKKAAALFDSQAPICPICQVLLRPSELQEHM
EQELEQLAQLPSSKNSLLKDAMAPGTPKSLLLSASIKREGESPTASPHSSATDDLHHSDR
YQTFLRVRANRQTRLNARIGKMKRRKQDEGQREGSCMAEDDAVDIEHENNNRFEEYEWCG
QKRIRATTLLEGGFRGSGFIMCSGKENPDSDADLDVDGDDTLEYGKPQYTEADVIPCTGE
EPGEAKEREALRGAVLNGGPPSTRITPEFSKWASDEMPSTSNGESSKQEAMQKTCKNSDI
EKITEDSAVTTFEALKARVRELERQLSRGDRYKCLICMDSYSMPLTSIQCWHVHCEECWL
RTLGAKKLCPQCNTITAPGDLRRIYL

Sequence length

566

Interactions

View interactions

	Reactome
			Antigen processing: Ubiquitination & Proteasome degradation

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Leukodystrophy, hypomyelinating, 23, with ataxia, deafness, liver dysfunction, and dilated cardiomyopathy	Pathogenic	rs1010750511, rs780921270	RCV001810395 RCV001807781

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Neurodegenerative Diseases	Associate	36789492
TDP 43 Proteinopathies	Associate	36789492

RNF220 (ring finger protein 220)