Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	55072
Gene name Gene Name - the full gene name approved by the HGNC.	Ring finger protein 31
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RNF31
Synonyms (NCBI Gene) Gene synonyms aliases	HOIP, IMD115, Paul, ZIBRA
Disease Acronyms (UniProt) Disease acronyms from UniProt database	IMD115
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q12
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-DNA and protein-protein interactions. The encoded protein is the E3 ubiquitin-protein ligase compon

Show/Hide all(2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs377035972	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs1566615893	A>G	Likely-pathogenic	Coding sequence variant, missense variant

Show/Hide all(18)

miRTarBase ID	miRNA	Experiments
MIRT1312504	hsa-miR-1200	CLIP-seq
MIRT1312505	hsa-miR-1287	CLIP-seq
MIRT1312506	hsa-miR-1972	CLIP-seq
MIRT1312507	hsa-miR-3126-5p	CLIP-seq
MIRT1312508	hsa-miR-3135b	CLIP-seq
MIRT1312509	hsa-miR-3157-3p	CLIP-seq
MIRT1312510	hsa-miR-3649	CLIP-seq
MIRT1312511	hsa-miR-3907	CLIP-seq
MIRT1312512	hsa-miR-4290	CLIP-seq
MIRT1312513	hsa-miR-4324	CLIP-seq
MIRT1312514	hsa-miR-4326	CLIP-seq
MIRT1312515	hsa-miR-4419a	CLIP-seq
MIRT1312516	hsa-miR-4510	CLIP-seq
MIRT1312517	hsa-miR-4633-3p	CLIP-seq
MIRT1312518	hsa-miR-4690-5p	CLIP-seq
MIRT1312519	hsa-miR-544b	CLIP-seq
MIRT1312520	hsa-miR-874	CLIP-seq
MIRT1312514	hsa-miR-4326	CLIP-seq

Show/Hide all(19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000209	Process	Protein polyubiquitination	IDA	12629548, 17006537
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	17006537
GO:0005515	Function	Protein binding	IPI	16713569, 17006537, 21455173, 21455180, 21455181, 21811235, 21903422, 21988832, 22158122, 22430200, 22791023, 23032186, 23104095, 23708998, 24141947, 24726323, 24726327, 26789245, 26997266, 27458237, 27523608, 27545878, 27559085, 27591049, 28514442, 29892012, 29997244, 30561431, 328
GO:0005829	Component	Cytosol	TAS
GO:0007249	Process	I-kappaB kinase/NF-kappaB signaling	TAS
GO:0009898	Component	Cytoplasmic side of plasma membrane	ISS	20614026
GO:0010803	Process	Regulation of tumor necrosis factor-mediated signaling pathway	TAS
GO:0023035	Process	CD40 signaling pathway	ISS
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	23453807
GO:0035631	Component	CD40 receptor complex	ISS
GO:0042802	Function	Identical protein binding	IPI	29892012, 30561431
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	19136968, 21455173
GO:0043130	Function	Ubiquitin binding	IDA	21455181
GO:0046872	Function	Metal ion binding	IEA
GO:0050852	Process	T cell receptor signaling pathway	IDA	20005846
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	19136968
GO:0071797	Component	LUBAC complex	IDA	17006537, 21455173, 21455180, 21455181, 24726323, 27523608
GO:0097039	Process	Protein linear polyubiquitination	IDA	21455173, 21455180, 21455181, 23453807
GO:1903955	Process	Positive regulation of protein targeting to mitochondrion	HMP	24270810

MIM	HGNC	e!Ensembl
612487	16031	ENSG00000092098

Protein

UniProt ID

Q96EP0

Protein name

E3 ubiquitin-protein ligase RNF31 (EC 2.3.2.31) (HOIL-1-interacting protein) (HOIP) (RING finger protein 31) (RING-type E3 ubiquitin transferase RNF31) (Zinc in-between-RING-finger ubiquitin-associated domain protein)

Protein function

E3 ubiquitin-protein ligase component of the LUBAC complex which conjugates linear ('Met-1'-linked) polyubiquitin chains to substrates and plays a key role in NF-kappa-B activation and regulation of inflammation (PubMed:17006537, PubMed:19136968

PDB

2CT7 , 4DBG , 4JUY , 4LJO , 4LJP , 4LJQ , 4OWF , 4OYJ , 4OYK , 4P09 , 4P0A , 4P0B , 5EDV , 5LJN , 5X0W , 6GZY , 6KC5 , 6KC6 , 6SC5 , 6SC6 , 6SC7 , 6SC8 , 6SC9 , 7TV4 , 7UY2 , 7UYJ , 7UYK , 7V8F , 7V8G , 8Z30 , 8Z36 , 9AZJ , 9B0B , 9B0Z , 9B12

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF18486	PUB_1	1 → 65	PNGase/UBA- or UBX-containing domain	Domain
PF09409	PUB	69 → 150	PUB domain	Domain
PF16678	HOIP-UBA	483 → 628	HOIP UBA domain pair	Family
PF01485	IBR	779 → 841	IBR domain, a half RING-finger domain	Domain
PF18091	E3_UbLigase_RBR	940 → 1032	E3 Ubiquitin Ligase RBR C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in both normal and transformed breast epithelial cell lines. {ECO:0000269|PubMed:15093743}.

Sequence

MPGEEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAARLVRCN
AHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLR
LYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQLLED
KVEDDMLQLSEFDPLLREIAPGPLTTPSVPGSTPGPCFLCGSAPGTLHCPSCKQALCPAC
DHLFHGHPSRAHHLRQTLPGVLQGTHLSPSLPASAQPRPQSTSLLALGDSSLSSPNPASA
HLPWHCAACAMLNEPWAVLCVACDRPRGCKGLGLGTEGPQGTGGLEPDLARGRWACQSCT
FENEAAAVLCSICERPRLAQPPSLVVDSRDAGICLQPLQQGDALLASAQSQVWYCIHCTF
CNSSPGWVCVMCNRTSSPIPAQHAPRPYASSLEKGPPKPGPPRRLSAPLPSSCGDPEKQR
QDKMREEGLQLVSMIREGEAAGACPEEIFSALQYSGTEVPLQWLRSELPYVLEMVAELAG
QQDPGLGAFSCQEARRAWLDRHGNLDEAVEECVRTRRRKVQELQSLGFGPEEGSLQALFQ
HGGDVSRALTELQRQRLEPFRQRLWDSGPEPTPSWDGPDKQSLVRRLLAVYALPSWGRAE
LALSLLQETPRNYELGDVVEAVRHSQDRAFLRRLLAQECAVCGWALPHNRMQALTSCECT
ICPDCFRQHFTIALKEKHITDMVCPACGRPDLTDDTQLLSYFSTLDIQLRESLEPDAYAL
FHKKLTEGVLMRDPKFLWCAQCSFGFIYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRS
CEDFQNWKRMNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSG
CYNAFYAKNKCPEPNCRVKKSLHGHHPRDCLFYLRDWTALRLQKLLQDNNVMFNTEPPAG
ARAVPGGGCRVIEQKEVPNGLRDEACGKETPAGYAGLCQAHYKEYLVSLINAHSLDPATL
YEVEELETATERYLHVRPQPLAGEDPPAYQARLLQKLTEEVPLGQSIPRRRK

Sequence length

1072

Interactions

View interactions

	KEGG		Reactome
	Necroptosis NOD-like receptor signaling pathway Shigellosis		Regulation of TNFR1 signaling TNFR1-induced NFkappaB signaling pathway

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	29610475

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Immunodeficiency	immunodeficiency 115 with autoinflammation			GenCC

Show/Hide Text Mining Associations (18)

Disease Name	Relationship Type	References
Associations from Text Mining
Breast Neoplasms	Associate	24441041, 26148235, 36581998
Breast Neoplasms	Stimulate	29763465
Carcinoma Hepatocellular	Associate	37117215, 38172174
Familial cylindromatosis	Associate	24461064
Gamma A Globulin Defect in Assembly of	Associate	30936877
Glioma	Stimulate	38002938
Glycogen Storage Disease Type IV	Associate	26008899
Hereditary Autoinflammatory Diseases	Associate	26008899, 32122970
Immunologic Deficiency Syndromes	Associate	26008899, 30936877
Inflammation	Associate	26008899, 38172174
Lymphangiectasis Intestinal	Associate	26008899
Lymphoma Large B Cell Diffuse	Associate	27777308
Melanoma	Associate	34467615
Neoplasms	Associate	24686174, 29763465, 34467615, 36811466, 37117215, 38002938, 38172174
Neoplasms	Inhibit	36581998
Ovarian Neoplasms	Associate	24686174
Stomach Neoplasms	Associate	30389786
Triple Negative Breast Neoplasms	Inhibit	36581998

RNF31 (ring finger protein 31)