Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	55062
Gene name Gene Name - the full gene name approved by the HGNC.	WD repeat domain, phosphoinositide interacting 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	WIPI1
Synonyms (NCBI Gene) Gene synonyms aliases	ATG18, ATG18A, WIPI49
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q24.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a WD40 repeat protein. Members of the WD40 repeat family are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversibl

Show/Hide all(80)

miRTarBase ID	miRNA	Experiments
MIRT1493011	hsa-miR-1254	CLIP-seq
MIRT1493012	hsa-miR-3116	CLIP-seq
MIRT1493013	hsa-miR-3152-5p	CLIP-seq
MIRT1493014	hsa-miR-3613-3p	CLIP-seq
MIRT1493015	hsa-miR-3667-3p	CLIP-seq
MIRT1493016	hsa-miR-4297	CLIP-seq
MIRT1493017	hsa-miR-4774-3p	CLIP-seq
MIRT1493018	hsa-miR-4794	CLIP-seq
MIRT1493019	hsa-miR-502-5p	CLIP-seq
MIRT1493020	hsa-miR-515-5p	CLIP-seq
MIRT1493021	hsa-miR-548u	CLIP-seq
MIRT1493022	hsa-miR-661	CLIP-seq
MIRT1493023	hsa-miR-718	CLIP-seq
MIRT2369047	hsa-miR-1471	CLIP-seq
MIRT2369048	hsa-miR-182	CLIP-seq
MIRT2441667	hsa-miR-136	CLIP-seq
MIRT2441668	hsa-miR-25	CLIP-seq
MIRT2441669	hsa-miR-32	CLIP-seq
MIRT2441670	hsa-miR-363	CLIP-seq
MIRT1493015	hsa-miR-3667-3p	CLIP-seq
MIRT2441671	hsa-miR-367	CLIP-seq
MIRT2441672	hsa-miR-377	CLIP-seq
MIRT1493016	hsa-miR-4297	CLIP-seq
MIRT2441673	hsa-miR-4325	CLIP-seq
MIRT1493019	hsa-miR-502-5p	CLIP-seq
MIRT1493023	hsa-miR-718	CLIP-seq
MIRT2441674	hsa-miR-92a	CLIP-seq
MIRT2441675	hsa-miR-92b	CLIP-seq
MIRT2441667	hsa-miR-136	CLIP-seq
MIRT2662491	hsa-miR-218	CLIP-seq
MIRT2441668	hsa-miR-25	CLIP-seq
MIRT2662492	hsa-miR-2964a-5p	CLIP-seq
MIRT2441669	hsa-miR-32	CLIP-seq
MIRT2662493	hsa-miR-3622a-3p	CLIP-seq
MIRT2662494	hsa-miR-3622b-3p	CLIP-seq
MIRT2441670	hsa-miR-363	CLIP-seq
MIRT1493015	hsa-miR-3667-3p	CLIP-seq
MIRT2441671	hsa-miR-367	CLIP-seq
MIRT2441672	hsa-miR-377	CLIP-seq
MIRT2662495	hsa-miR-4278	CLIP-seq
MIRT1493016	hsa-miR-4297	CLIP-seq
MIRT2662496	hsa-miR-4303	CLIP-seq
MIRT2441673	hsa-miR-4325	CLIP-seq
MIRT2662497	hsa-miR-4525	CLIP-seq
MIRT2662498	hsa-miR-4649-3p	CLIP-seq
MIRT2662499	hsa-miR-4716-3p	CLIP-seq
MIRT2662500	hsa-miR-4762-3p	CLIP-seq
MIRT1493019	hsa-miR-502-5p	CLIP-seq
MIRT1493020	hsa-miR-515-5p	CLIP-seq
MIRT2662501	hsa-miR-548aa	CLIP-seq
MIRT2662502	hsa-miR-636	CLIP-seq
MIRT1493023	hsa-miR-718	CLIP-seq
MIRT2441674	hsa-miR-92a	CLIP-seq
MIRT2441675	hsa-miR-92b	CLIP-seq
MIRT2441667	hsa-miR-136	CLIP-seq
MIRT2662491	hsa-miR-218	CLIP-seq
MIRT2441668	hsa-miR-25	CLIP-seq
MIRT2662492	hsa-miR-2964a-5p	CLIP-seq
MIRT2441669	hsa-miR-32	CLIP-seq
MIRT2662493	hsa-miR-3622a-3p	CLIP-seq
MIRT2662494	hsa-miR-3622b-3p	CLIP-seq
MIRT2441670	hsa-miR-363	CLIP-seq
MIRT1493015	hsa-miR-3667-3p	CLIP-seq
MIRT2441671	hsa-miR-367	CLIP-seq
MIRT2441672	hsa-miR-377	CLIP-seq
MIRT2662495	hsa-miR-4278	CLIP-seq
MIRT1493016	hsa-miR-4297	CLIP-seq
MIRT2662496	hsa-miR-4303	CLIP-seq
MIRT2441673	hsa-miR-4325	CLIP-seq
MIRT2662497	hsa-miR-4525	CLIP-seq
MIRT2662498	hsa-miR-4649-3p	CLIP-seq
MIRT2662499	hsa-miR-4716-3p	CLIP-seq
MIRT2662500	hsa-miR-4762-3p	CLIP-seq
MIRT1493019	hsa-miR-502-5p	CLIP-seq
MIRT1493020	hsa-miR-515-5p	CLIP-seq
MIRT2662501	hsa-miR-548aa	CLIP-seq
MIRT2662502	hsa-miR-636	CLIP-seq
MIRT1493023	hsa-miR-718	CLIP-seq
MIRT2441674	hsa-miR-92a	CLIP-seq
MIRT2441675	hsa-miR-92b	CLIP-seq

Show/Hide all(41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000045	Process	Autophagosome assembly	IMP	28561066
GO:0000139	Component	Golgi membrane	TAS
GO:0000407	Component	Phagophore assembly site	IDA	15602573, 28561066, 33499712
GO:0000407	Component	Phagophore assembly site	IEA
GO:0000421	Component	Autophagosome membrane	IDA	17618624
GO:0000422	Process	Autophagy of mitochondrion	IBA
GO:0000425	Process	Pexophagy	IBA
GO:0005102	Function	Signaling receptor binding	IDA	15602573
GO:0005515	Function	Protein binding	IPI	28561066
GO:0005737	Component	Cytoplasm	IDA	17618624
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005802	Component	Trans-Golgi network	IDA	15020712
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0006914	Process	Autophagy	IEA
GO:0006914	Process	Autophagy	IEP	15602573, 17618624
GO:0008289	Function	Lipid binding	IEA
GO:0009267	Process	Cellular response to starvation	IDA	28561066
GO:0010008	Component	Endosome membrane	IDA	15020712
GO:0016020	Component	Membrane	IEA
GO:0030136	Component	Clathrin-coated vesicle	IEA
GO:0030331	Function	Nuclear estrogen receptor binding	IDA	15602573
GO:0030674	Function	Protein-macromolecule adaptor activity	IBA
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	28561066
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032266	Function	Phosphatidylinositol-3-phosphate binding	IBA
GO:0032266	Function	Phosphatidylinositol-3-phosphate binding	IDA	15020712, 20505359, 28561066, 31271352
GO:0034045	Component	Phagophore assembly site membrane	IBA
GO:0034045	Component	Phagophore assembly site membrane	IDA	17618624
GO:0034045	Component	Phagophore assembly site membrane	IEA
GO:0034497	Process	Protein localization to phagophore assembly site	IBA
GO:0044804	Process	Nucleophagy	IBA
GO:0048203	Process	Vesicle targeting, trans-Golgi to endosome	IDA	15020712
GO:0050681	Function	Nuclear androgen receptor binding	IDA	15602573
GO:0061723	Process	Glycophagy	IBA
GO:0080025	Function	Phosphatidylinositol-3,5-bisphosphate binding	IBA
GO:0080025	Function	Phosphatidylinositol-3,5-bisphosphate binding	IDA	20505359, 28561066
GO:2000786	Process	Positive regulation of autophagosome assembly	IDA	31271352

MIM	HGNC	e!Ensembl
609224	25471	ENSG00000070540

Protein

UniProt ID

Q5MNZ9

Protein name

WD repeat domain phosphoinositide-interacting protein 1 (WIPI-1) (Atg18 protein homolog) (WD40 repeat protein interacting with phosphoinositides of 49 kDa) (WIPI 49 kDa)

Protein function

Component of the autophagy machinery that controls the major intracellular degradation process by which cytoplasmic materials are packaged into autophagosomes and delivered to lysosomes for degradation (PubMed:15602573, PubMed:20114074, PubMed:2

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed. Highly expressed in skeletal muscle, heart, testis, pancreas and placenta. Highly expressed in G361, Sk-mel-28, Sk-mel-13, WM852 and WM451 cells. Up-regulated in a variety of tumor tissues. {ECO:0000269|PubMed:1

Sequence

MEAEAADAPPGGVESALSCFSFNQDCTSLATGTKAGYKLFSLSSVEQLDQVHGSNEIPDV
YIVERLFSSSLVVVVSHTKPRQMNVYHFKKGTEICNYSYSSNILSIRLNRQRLLVCLEES
IYIHNIKDMKLLKTLLDIPANPTGLCALSINHSNSYLAYPGSLTSGEIVLYDGNSLKTVC
TIAAHEGTLAAITFNASGSKLASASEKGTVIRVFSVPDGQKLYEFRRGMKRYVTISSLVF
SMDSQFLCASSNTETVHIFKLEQVTNSRPEEPSTWSGYMGKMFMAATNYLPTQVSDMMHQ
DRAFATARLNFSGQRNICTLSTIQKLPRLLVASSSGHLYMYNLDPQDGGECVLIKTHSLL
GSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRGEVIPEHEFATGP
VCLDDENEFPPIILCRGNQKGKTKQS

Sequence length

446

Interactions

View interactions

	KEGG		Reactome
	Autophagy - other Autophagy - animal Alzheimer disease Amyotrophic lateral sclerosis Huntington disease Spinocerebellar ataxia Pathways of neurodegeneration - multiple diseases Shigellosis		Macroautophagy XBP1(S) activates chaperone genes

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Coronary artery disease	Coronary artery disease	N/A	N/A	GWAS
Diabetes	Type 2 diabetes	N/A	N/A	GWAS

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Breast Neoplasms	Associate	31759986
Carcinogenesis	Associate	24991767
Diabetes Mellitus Type 2	Associate	28252104
Isodicentric Chromosome 15 Syndrome	Inhibit	24991767
Leukemia Myeloid Acute	Inhibit	24991767
Leukemia Promyelocytic Acute	Associate	24991767
Melanoma	Associate	30622661
Neoplasms	Associate	24991767
Osteosarcoma	Associate	34335109

WIPI1 (WD repeat domain, phosphoinositide interacting 1)