Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
55005
Gene name Gene Name - the full gene name approved by the HGNC.
Required for meiotic nuclear division 1 homolog
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RMND1
Synonyms (NCBI Gene) Gene synonyms aliases
C6orf96, COXPD11, RMD1, bA351K16, bA351K16.3
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q25.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene belongs to the evolutionary conserved sif2 family of proteins that share the DUF155 domain in common. This protein is thought to be localized in the mitochondria and involved in mitochondrial translation. Mutations in this
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs115079861 C>G,T Benign, pathogenic Non coding transcript variant, stop lost, terminator codon variant, synonymous variant
rs142521318 G>A Conflicting-interpretations-of-pathogenicity Missense variant, non coding transcript variant, coding sequence variant
rs144972972 T>C Pathogenic, conflicting-interpretations-of-pathogenicity Coding sequence variant, non coding transcript variant, missense variant
rs370863743 G>A,T Pathogenic Missense variant, non coding transcript variant, coding sequence variant, 5 prime UTR variant
rs397515421 C>T Pathogenic Missense variant, non coding transcript variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT681418 hsa-miR-106a-5p HITS-CLIP 23706177
MIRT681417 hsa-miR-106b-5p HITS-CLIP 23706177
MIRT681416 hsa-miR-17-5p HITS-CLIP 23706177
MIRT681415 hsa-miR-20a-5p HITS-CLIP 23706177
MIRT681414 hsa-miR-20b-5p HITS-CLIP 23706177
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 28514442, 32814053, 33961781
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IDA 25604853
GO:0005739 Component Mitochondrion IEA
GO:0006412 Process Translation IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
614917 21176 ENSG00000155906
Protein
UniProt ID Q9NWS8
Protein name Required for meiotic nuclear division protein 1 homolog
Protein function Required for mitochondrial translation, possibly by coordinating the assembly or maintenance of the mitochondrial ribosome (PubMed:23022098, PubMed:25604853).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02582 DUF155 226 403 Uncharacterised ACR, YagE family COG1723 Family
Sequence
MPATLLRAVARSHHILSKAHQCRRIGHLMLKPLKEFENTTCSTLTIRQSLDLFLPDKTAS
GLNKSQILEMNQKKSDTSMLSPLNAARCQDEKAHLPTMKSFGTHRRVTHKPNLLGSKWFI
KILKRHFSSVSTETFVPKQDFPQVKRPLKASRTRQPSRTNLPVLSVNEDLMHCTAFATAD
EYHLGNLSQDLASHGYVEVTSLPRDAANILVMGVENSAKEGDPGTIFFFREGAAVFWNVK
DKTMKHVMKVLEKHEIQPYEIALVHWENEELNYIKIEGQSKLHRGEIKLNSELDLDDAIL
EKFAFSNALCLSVKLAIWEASLDKFIESIQSIPEALKAGKKVKLSHEEVMQKIGELFALR
HRINLSSDFLITPDFYWDRENLEGLYDKTCQFLSIGRRVKVMN
EKLQHCMELTDLMRNHL
NEKRALRLEWMIVILITIEVMFELGRVFF
Sequence length 449
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Combined Oxidative Phosphorylation Deficiency combined oxidative phosphorylation defect type 11 rs606231472, rs1582970514, rs1582957532, rs1562800908, rs397515421, rs771894262, rs115079861, rs759477396, rs144972972, rs1057519299, rs763658299 N/A
Fatal Mitochondrial Disease Mitochondrial disease rs886037773, rs886037771, rs773470671, rs771894262, rs397515421, rs886037772, rs115079861, rs370863743, rs144972972 N/A
Nephronophthisis nephronophthisis rs144972972 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Uterine Fibroids Uterine fibroids N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acidosis Lactic Associate 25604853
Brain Diseases Associate 23022098
Breast Neoplasms Stimulate 21552322
Cardiomyopathy Dilated Associate 27350610
Combined Oxidative Phosphorylation Deficiency 1 Associate 32911714
Deafness Associate 25058219, 25604853, 27350610
Gonadal dysgenesis XX type deafness Associate 32911714
Hearing Loss Associate 25604853, 32911714
Hypoaldosteronism Associate 37450011
Hypomagnesemia 5 Renal with Ocular Involvement Associate 25058219, 32911714