Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
55005
Gene name Gene Name - the full gene name approved by the HGNC.
Required for meiotic nuclear division 1 homolog
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RMND1
Synonyms (NCBI Gene) Gene synonyms aliases
C6orf96, COXPD11, RMD1, bA351K16, bA351K16.3
Disease Acronyms (UniProt) Disease acronyms from UniProt database
COXPD11
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q25.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene belongs to the evolutionary conserved sif2 family of proteins that share the DUF155 domain in common. This protein is thought to be localized in the mitochondria and involved in mitochondrial translation. Mutations in this
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs115079861 C>G,T Benign, pathogenic Non coding transcript variant, stop lost, terminator codon variant, synonymous variant
rs142521318 G>A Conflicting-interpretations-of-pathogenicity Missense variant, non coding transcript variant, coding sequence variant
rs144972972 T>C Pathogenic, conflicting-interpretations-of-pathogenicity Coding sequence variant, non coding transcript variant, missense variant
rs370863743 G>A,T Pathogenic Missense variant, non coding transcript variant, coding sequence variant, 5 prime UTR variant
rs397515421 C>T Pathogenic Missense variant, non coding transcript variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT681418 hsa-miR-106a-5p HITS-CLIP 23706177
MIRT681417 hsa-miR-106b-5p HITS-CLIP 23706177
MIRT681416 hsa-miR-17-5p HITS-CLIP 23706177
MIRT681415 hsa-miR-20a-5p HITS-CLIP 23706177
MIRT681414 hsa-miR-20b-5p HITS-CLIP 23706177
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956
GO:0005739 Component Mitochondrion IDA 25604853
GO:0006412 Process Translation IEA
GO:0070131 Process Positive regulation of mitochondrial translation IBA 21873635
GO:0070131 Process Positive regulation of mitochondrial translation IDA 25604853
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
614917 21176 ENSG00000155906
Protein
UniProt ID Q9NWS8
Protein name Required for meiotic nuclear division protein 1 homolog
Protein function Required for mitochondrial translation, possibly by coordinating the assembly or maintenance of the mitochondrial ribosome (PubMed:23022098, PubMed:25604853).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02582 DUF155 226 403 Uncharacterised ACR, YagE family COG1723 Family
Sequence
MPATLLRAVARSHHILSKAHQCRRIGHLMLKPLKEFENTTCSTLTIRQSLDLFLPDKTAS
GLNKSQILEMNQKKSDTSMLSPLNAARCQDEKAHLPTMKSFGTHRRVTHKPNLLGSKWFI
KILKRHFSSVSTETFVPKQDFPQVKRPLKASRTRQPSRTNLPVLSVNEDLMHCTAFATAD
EYHLGNLSQDLASHGYVEVTSLPRDAANILVMGVENSAKEGDPGTIFFFREGAAVFWNVK
DKTMKHVMKVLEKHEIQPYEIALVHWENEELNYIKIEGQSKLHRGEIKLNSELDLDDAIL
EKFAFSNALCLSVKLAIWEASLDKFIESIQSIPEALKAGKKVKLSHEEVMQKIGELFALR
HRINLSSDFLITPDFYWDRENLEGLYDKTCQFLSIGRRVKVMN
EKLQHCMELTDLMRNHL
NEKRALRLEWMIVILITIEVMFELGRVFF
Sequence length 449
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
29915430
Breast carcinoma Breast Carcinoma rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451
View all (71 more)
29915430
Combined oxidative phosphorylation deficiency COMBINED OXIDATIVE PHOSPHORYLATION DEFICIENCY 11, Combined oxidative phosphorylation defect type 11 rs587776508, rs576462794, rs118203917, rs387906327, rs139430866, rs387906962, rs138119149, rs387907061, rs1562800908, rs397515421, rs397514598, rs397514610, rs397514611, rs397514612, rs201431517
View all (155 more)
23022099, 23022098, 25604853, 26238252, 27604308, 25058219
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Unknown
Disease term Disease name Evidence References Source
Renal dysplasia Renal Cell Dysplasia, Renal dysplasia ClinVar
Renal hypoplasia Congenital hypoplasia of kidney ClinVar
Mitochondrial Diseases mitochondrial disease GenCC
Uterine Fibroids Uterine Fibroids GWAS
Associations from Text Mining
Disease Name Relationship Type References
Acidosis Lactic Associate 25604853
Brain Diseases Associate 23022098
Breast Neoplasms Stimulate 21552322
Cardiomyopathy Dilated Associate 27350610
Combined Oxidative Phosphorylation Deficiency 1 Associate 32911714
Deafness Associate 25058219, 25604853, 27350610
Gonadal dysgenesis XX type deafness Associate 32911714
Hearing Loss Associate 25604853, 32911714
Hypoaldosteronism Associate 37450011
Hypomagnesemia 5 Renal with Ocular Involvement Associate 25058219, 32911714