Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55
Gene name	Acid phosphatase 3
Gene symbol	ACP3
Synonyms (NCBI Gene)	5'-NTACP-3ACPPTM-PAP
Chromosome	3
Chromosome location	3q22.1
Summary	This gene encodes an enzyme that catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is synthesized under androgen regulation and is secreted by the epithelial cells of the prostate gland. An alternatively spliced trans

Show/Hide all (54)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003993	Function	Acid phosphatase activity	IDA	10506173
GO:0003993	Function	Acid phosphatase activity	IEA
GO:0003993	Function	Acid phosphatase activity	IMP	8132635
GO:0004725	Function	Protein tyrosine phosphatase activity	IEA
GO:0005515	Function	Protein binding	IPI	9705354
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IDA	10639192, 15280042
GO:0005615	Component	Extracellular space	IMP	22389722
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005771	Component	Multivesicular body	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	17658863
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006144	Process	Purine nucleobase metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006772	Process	Thiamine metabolic process	IEA
GO:0006772	Process	Thiamine metabolic process	ISS
GO:0008253	Function	5'-nucleotidase activity	IDA	18940592
GO:0008253	Function	5'-nucleotidase activity	IEA
GO:0009117	Process	Nucleotide metabolic process	IEA
GO:0012506	Component	Vesicle membrane	IEA
GO:0012506	Component	Vesicle membrane	ISS
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016791	Function	Phosphatase activity	IBA
GO:0016791	Function	Phosphatase activity	IMP	18940592, 22389722
GO:0030141	Component	Secretory granule	IEA
GO:0030175	Component	Filopodium	IEA
GO:0031985	Component	Golgi cisterna	IEA
GO:0033265	Function	Choline binding	IEA
GO:0035577	Component	Azurophil granule membrane	TAS
GO:0042131	Function	Thiamine phosphate phosphatase activity	IEA
GO:0042131	Function	Thiamine phosphate phosphatase activity	ISS
GO:0042802	Function	Identical protein binding	IPI	18083097, 24657436
GO:0042803	Function	Protein homodimerization activity	IDA	10639192
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0045177	Component	Apical part of cell	IEA
GO:0046085	Process	Adenosine metabolic process	IDA	18940592
GO:0046085	Process	Adenosine metabolic process	IEA
GO:0051930	Process	Regulation of sensory perception of pain	IBA
GO:0051930	Process	Regulation of sensory perception of pain	IEA
GO:0051930	Process	Regulation of sensory perception of pain	IMP	18940592, 22389722
GO:0052642	Function	Lysophosphatidic acid phosphatase activity	IDA	15280042
GO:0060090	Function	Molecular adaptor activity	EXP	19995078
GO:0060168	Process	Positive regulation of adenosine receptor signaling pathway	IBA
GO:0060168	Process	Positive regulation of adenosine receptor signaling pathway	IMP	18940592, 22389722
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145

MIM	HGNC	e!Ensembl
171790	125	ENSG00000014257

P15309

Protein name

Prostatic acid phosphatase (PAP) (EC 3.1.3.2) (5'-nucleotidase) (5'-NT) (EC 3.1.3.5) (Acid phosphatase 3) (Ecto-5'-nucleotidase) (Protein tyrosine phosphatase ACP3) (EC 3.1.3.48) (Thiamine monophosphatase) (TMPase) [Cleaved into: PAPf39]

Protein function

A non-specific tyrosine phosphatase that dephosphorylates a diverse number of substrates under acidic conditions (pH 4-6) including alkyl, aryl, and acyl orthophosphate monoesters and phosphorylated proteins (PubMed:10506173, PubMed:15280042, Pu

PDB

1CVI , 1ND5 , 1ND6 , 2HPA , 2L3H , 2L77 , 2L79 , 2MG0 , 3PPD , 7ZZV , 8XJ4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00328	His_Phos_2	50 → 332	Histidine phosphatase superfamily (branch 2)	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in the prostate, restricted to glandular and ductal epithelial cells. Also expressed in bladder, kidney, pancreas, lung, cervix, testis and ovary. Weak expression in a subset of pancreatic islet cells, squamous epithel

Sequence

MRAAPLLLARAASLSLGFLFLLFFWLDRSVLAKELKFVTLVFRHGDRSPIDTFPTDPIKE
SSWPQGFGQLTQLGMEQHYELGEYIRKRYRKFLNESYKHEQVYIRSTDVDRTLMSAMTNL
AALFPPEGVSIWNPILLWQPIPVHTVPLSEDQLLYLPFRNCPRFQELESETLKSEEFQKR
LHPYKDFIATLGKLSGLHGQDLFGIWSKVYDPLYCESVHNFTLPSWATEDTMTKLRELSE
LSLLSLYGIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMYSAHDTTVSGLQMAL
DVYNGLLPPYASCHLTELYFEKGEYFVEMYYRNETQHEPYPLMLPGCSPSCPLERFAELV
GPVIPQDWSTECMTTNSHQGTEDSTD

Sequence length

386

Interactions

View interactions

	Reactome
			Neutrophil degranulation

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute megakaryoblastic leukemia	Uncertain significance	rs864309497	RCV000202571
Mediastinal germ cell tumor	Uncertain significance	rs864309497	RCV000202571

Show/Hide Text Mining Associations (28)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acro Osteolysis	Associate	24242705
Adenocarcinoma	Associate	15859643
Alzheimer Disease	Associate	27357282
Alzheimer Disease	Stimulate	28060825
Anxiety	Associate	27357282
Brain Diseases	Associate	27357282
Carcinoma Adenoid Cystic	Associate	33021555
Depressive Disorder	Associate	27357282
Giant Cell Tumors	Associate	15859643
Lung Neoplasms	Inhibit	33728331
Neoplasm Metastasis	Associate	24242705, 28555048
Neoplasms	Associate	16857057, 21986992
Neoplasms	Stimulate	22986220
Neoplasms	Inhibit	27357282
Neurodegenerative Diseases	Associate	27357282
Ovarian Diseases	Inhibit	35185790
Parkinson Disease	Associate	27357282
Polyps	Associate	33021555
Prostate Cancer Hereditary 7	Associate	33204318
Prostatic Diseases	Associate	19128049
Prostatic Hyperplasia	Associate	16091476
Prostatic Neoplasms	Associate	11067847, 15240830, 16091476, 19128049, 22986220, 23775902, 24242705, 2482115, 24850844, 25591398, 25667921, 27357282, 27509056, 28555048, 37008945, 9488733 View all (1 more)
Prostatic Neoplasms Castration Resistant	Associate	24242705
Prostatitis	Associate	33021555
Schizophrenia	Associate	27357282
Sleep Apnea Obstructive	Associate	34529670
Urethral Neoplasms	Associate	29938870
Virilism	Associate	20126616

ACP3 (acid phosphatase 3)