BANP (BTG3 associated nuclear protein)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
54971
Gene name Gene Name - the full gene name approved by the HGNC.
BTG3 associated nuclear protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BANP
Synonyms (NCBI Gene) Gene synonyms aliases
BEND1, SMAR1, SMARBP1
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16q24.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that binds to matrix attachment regions. The protein forms a complex with p53 and negatively regulates p53 transcription, and functions as a tumor suppressor and cell cycle regulator. Multiple transcript variants encoding diffe
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(191)
miRTarBase ID miRNA Experiments Reference
MIRT438652 hsa-miR-320a ChIP-seq, Luciferase reporter assay, qRT-PCR, Western blot 23876508
MIRT438652 hsa-miR-320a ChIP-seq, Luciferase reporter assay, qRT-PCR, Western blot 23876508
MIRT438652 hsa-miR-320a ChIP-seq, Luciferase reporter assay, qRT-PCR, Western blot 23876508
MIRT438652 hsa-miR-320a ChIP-seq, Luciferase reporter assay, qRT-PCR, Western blot 23876508
MIRT487490 hsa-miR-6085 PAR-CLIP 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(11)
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding IEA
GO:0003723 Function RNA binding IEA
GO:0005515 Function Protein binding IPI 16189514, 20075864, 21516116, 24722188, 25416956, 25910212, 26871637, 28514442, 31515488, 32296183, 32814053, 33961781, 38169650
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
611564 13450 ENSG00000172530
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q8N9N5
Protein name Protein BANP (BEN domain-containing protein 1) (Btg3-associated nuclear protein) (Scaffold/matrix-associated region-1-binding protein)
Protein function Controls V(D)J recombination during T-cell development by repressing T-cell receptor (TCR) beta enhancer function (By similarity). Binds to scaffold/matrix attachment region beta (S/MARbeta), an ATC-rich DNA sequence located upstream of the TCR
PDB 7YUG , 7YUK , 8HTX , 8YZT
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF10523 BEN 250 → 319 BEN domain Domain
Tissue specificity TISSUE SPECIFICITY: Down-regulated in breast cancer cell lines. {ECO:0000269|PubMed:16166625}.
Sequence 
MMSEHDLADVVQIAVEDLSPDHPVVLENHVVTDEDEPALKRQRLEINCQDPSIKTICLRL
DSIEAKLQALEATCKSLEEKLDLVTNKQHSPIQVPMVAGSPLGATQTCNKVRCVVPQTTV
ILNNDRQNAIVAKMEDPLSNRAPDSLENVISNAVPGRRQNTIVVKVPGQEDSHHEDGESG
SEASDSVSSCGQAGSQSIGSNVTLITLNSEEDYPNGTWLGDENNPEMRVRCAIIPSDMLH
ISTNCRTAEKMALTLLDYLFHREVQAVSNLSGQGKHGKKQLDPLTIYGIRCHLFYKFGIT
ESDWYRIKQSIDSKCRTAWRRKQRGQSLAVKSFSRRTPNSSSYCPSEPMMSTPPPASELP
QPQPQPQALHYALANAQQVQIHQIGEDGQVQVGHLHIAQVPQGEQVQITQDSEGNLQIHH
VGQDGQLLEATRIPCLLAPSVFKASSGQVLQGAQLIAVASSDPAAAGVDGSPLQGSDIQV
QYVQLAPVSDHTAGAQTAEALQPTLQPEMQLEHGAIQIQ
Sequence length 519
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Regulation of TP53 Activity through Association with Co-factors
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (5)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes, Triglyceride levels in non-type 2 diabetes N/A N/A GWAS
Ependymoma ependymoma N/A N/A ClinVar
Frontal Fibrosing Alopecia Frontal fibrosing alopecia N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Show/Hide Text Mining Associations (10)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 25157104
Breast Neoplasms Associate 16166625, 17668048, 17726044, 20153327, 25086032, 26080397, 26325577, 26629941, 28617439
Carcinoma Non Small Cell Lung Associate 24926985
Colorectal Neoplasms Associate 34689394
Infections Associate 25157104
Keratoconus Associate 26040312, 38267912
Neoplasm Metastasis Inhibit 17668048
Neoplasms Inhibit 16166625, 17668048, 17726044, 26325577, 28617439, 34689394
Neoplasms Associate 25086032, 26629941, 31422285
Virus Diseases Associate 31422285