BANP (BTG3 associated nuclear protein)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 54971
Gene name BTG3 associated nuclear protein
Gene symbol BANP
Synonyms (NCBI Gene)
BEND1SMAR1SMARBP1
Chromosome 16
Chromosome location 16q24.2
Summary This gene encodes a protein that binds to matrix attachment regions. The protein forms a complex with p53 and negatively regulates p53 transcription, and functions as a tumor suppressor and cell cycle regulator. Multiple transcript variants encoding diffe
miRNA miRNA information provided by mirtarbase database.
191
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (191)
miRTarBase ID miRNA Experiments Reference
MIRT438652 hsa-miR-320a ChIP-seqLuciferase reporter assayqRT-PCRWestern blot 23876508
MIRT438652 hsa-miR-320a ChIP-seqLuciferase reporter assayqRT-PCRWestern blot 23876508
MIRT438652 hsa-miR-320a ChIP-seqLuciferase reporter assayqRT-PCRWestern blot 23876508
MIRT438652 hsa-miR-320a ChIP-seqLuciferase reporter assayqRT-PCRWestern blot 23876508
MIRT487490 hsa-miR-6085 PAR-CLIP 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (11)
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding IEA
GO:0003723 Function RNA binding IEA
GO:0005515 Function Protein binding IPI 16189514, 20075864, 21516116, 24722188, 25416956, 25910212, 26871637, 28514442, 31515488, 32296183, 32814053, 33961781, 38169650
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
611564 13450 ENSG00000172530
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N9N5
Protein name Protein BANP (BEN domain-containing protein 1) (Btg3-associated nuclear protein) (Scaffold/matrix-associated region-1-binding protein)
Protein function Controls V(D)J recombination during T-cell development by repressing T-cell receptor (TCR) beta enhancer function (By similarity). Binds to scaffold/matrix attachment region beta (S/MARbeta), an ATC-rich DNA sequence located upstream of the TCR
PDB 7YUG , 7YUK , 8HTX , 8YZT
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF10523 BEN 250 → 319 BEN domain Domain
Tissue specificity TISSUE SPECIFICITY: Down-regulated in breast cancer cell lines. {ECO:0000269|PubMed:16166625}.
Sequence 
MMSEHDLADVVQIAVEDLSPDHPVVLENHVVTDEDEPALKRQRLEINCQDPSIKTICLRL
DSIEAKLQALEATCKSLEEKLDLVTNKQHSPIQVPMVAGSPLGATQTCNKVRCVVPQTTV
ILNNDRQNAIVAKMEDPLSNRAPDSLENVISNAVPGRRQNTIVVKVPGQEDSHHEDGESG
SEASDSVSSCGQAGSQSIGSNVTLITLNSEEDYPNGTWLGDENNPEMRVRCAIIPSDMLH
ISTNCRTAEKMALTLLDYLFHREVQAVSNLSGQGKHGKKQLDPLTIYGIRCHLFYKFGIT
ESDWYRIKQSIDSKCRTAWRRKQRGQSLAVKSFSRRTPNSSSYCPSEPMMSTPPPASELP
QPQPQPQALHYALANAQQVQIHQIGEDGQVQVGHLHIAQVPQGEQVQITQDSEGNLQIHH
VGQDGQLLEATRIPCLLAPSVFKASSGQVLQGAQLIAVASSDPAAAGVDGSPLQGSDIQV
QYVQLAPVSDHTAGAQTAEALQPTLQPEMQLEHGAIQIQ
Sequence length 519
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Regulation of TP53 Activity through Association with Co-factors
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Ependymoma Uncertain significance rs1555586650 RCV000577856
Show/Hide Text Mining Associations (10)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 25157104
Breast Neoplasms Associate 16166625, 17668048, 17726044, 20153327, 25086032, 26080397, 26325577, 26629941, 28617439
Carcinoma Non Small Cell Lung Associate 24926985
Colorectal Neoplasms Associate 34689394
Infections Associate 25157104
Keratoconus Associate 26040312, 38267912
Neoplasm Metastasis Inhibit 17668048
Neoplasms Inhibit 16166625, 17668048, 17726044, 26325577, 28617439, 34689394
Neoplasms Associate 25086032, 26629941, 31422285
Virus Diseases Associate 31422285