Gene Gene information from NCBI Gene database.
Entrez ID 54962
Gene name TIMELESS interacting protein
Gene symbol TIPIN
Synonyms (NCBI Gene)
-
Chromosome 15
Chromosome location 15q22.31
Summary The protein encoded by this gene is part of the replisome complex, a group of proteins that support DNA replication. It binds TIM, which is involved in circadian rhythm regulation, and aids in protecting cells against DNA damage and stress. Two pseudogene
miRNA miRNA information provided by mirtarbase database.
169
miRTarBase ID miRNA Experiments Reference
MIRT041905 hsa-miR-484 CLASH 23622248
MIRT696171 hsa-miR-508-5p HITS-CLIP 23313552
MIRT696170 hsa-miR-1273g-3p HITS-CLIP 23313552
MIRT696169 hsa-miR-6849-3p HITS-CLIP 23313552
MIRT696168 hsa-miR-766-3p HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
21
GO ID Ontology Definition Evidence Reference
GO:0000076 Process DNA replication checkpoint signaling IBA
GO:0000076 Process DNA replication checkpoint signaling IEA
GO:0000076 Process DNA replication checkpoint signaling IMP 17102137
GO:0000077 Process DNA damage checkpoint signaling IEA
GO:0000785 Component Chromatin IDA 17102137
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
610716 30750 ENSG00000075131
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BVW5
Protein name TIMELESS-interacting protein
Protein function Plays an important role in the control of DNA replication and the maintenance of replication fork stability (PubMed:17102137, PubMed:23359676, PubMed:35585232). Important for cell survival after DNA damage or replication stress (PubMed:17116885)
PDB 7PFO , 7PLO , 8B9D
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07962 Swi3 66 148 Replication Fork Protection Component Swi3 Family
Sequence
MLEPQENGVIDLPDYEHVEDETFPPFPPPASPERQDGEGTEPDEESGNGAPVRVPPKRTV
KRNIPKLDAQRLISERGLPALRHVFDKAKFKGKGHEAEDLKMLIRHMEHWAHRLFPKLQF
EDFIDRVEYLGSKKEVQTCLKRIRLDLP
ILHEDFVSNNDEVAENNEHDVTSTELDPFLTN
LSESEMFASELSRSLTEEQQQRIERNKQLALERRQAKLLSNSQTLGNDMLMNTPRAHTVE
EVNTDEDQKEESNGLNEDILDNPCNDAIANTLNEEETLLDQSFKNVQQQLDATSRNITEA
R
Sequence length 301
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Processing of DNA double-strand break ends