Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
54962
Gene name Gene Name - the full gene name approved by the HGNC.
TIMELESS interacting protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TIPIN
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
15q22.31
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is part of the replisome complex, a group of proteins that support DNA replication. It binds TIM, which is involved in circadian rhythm regulation, and aids in protecting cells against DNA damage and stress. Two pseudogene
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT041905 hsa-miR-484 CLASH 23622248
MIRT696171 hsa-miR-508-5p HITS-CLIP 23313552
MIRT696170 hsa-miR-1273g-3p HITS-CLIP 23313552
MIRT696169 hsa-miR-6849-3p HITS-CLIP 23313552
MIRT696168 hsa-miR-766-3p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000076 Process DNA replication checkpoint IBA 21873635
GO:0000076 Process DNA replication checkpoint IMP 17102137
GO:0000785 Component Chromatin IDA 17102137
GO:0003677 Function DNA binding IBA 21873635
GO:0005515 Function Protein binding IPI 17102137, 24126761, 24910198, 25416956, 32296183, 32814053
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610716 30750 ENSG00000075131
Protein
UniProt ID Q9BVW5
Protein name TIMELESS-interacting protein
Protein function Plays an important role in the control of DNA replication and the maintenance of replication fork stability (PubMed:17102137, PubMed:23359676, PubMed:35585232). Important for cell survival after DNA damage or replication stress (PubMed:17116885)
PDB 7PFO , 7PLO , 8B9D
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07962 Swi3 66 148 Replication Fork Protection Component Swi3 Family
Sequence
MLEPQENGVIDLPDYEHVEDETFPPFPPPASPERQDGEGTEPDEESGNGAPVRVPPKRTV
KRNIPKLDAQRLISERGLPALRHVFDKAKFKGKGHEAEDLKMLIRHMEHWAHRLFPKLQF
EDFIDRVEYLGSKKEVQTCLKRIRLDLP
ILHEDFVSNNDEVAENNEHDVTSTELDPFLTN
LSESEMFASELSRSLTEEQQQRIERNKQLALERRQAKLLSNSQTLGNDMLMNTPRAHTVE
EVNTDEDQKEESNGLNEDILDNPCNDAIANTLNEEETLLDQSFKNVQQQLDATSRNITEA
R
Sequence length 301
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Processing of DNA double-strand break ends
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Testicular Germ Cell Tumor Testicular Germ Cell Tumor GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 32345670
Carcinoma Hepatocellular Associate 35082931
Chromosome Aberrations Associate 39955949
Neoplasms Associate 32345670