Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
54845
Gene name Gene Name - the full gene name approved by the HGNC.
Epithelial splicing regulatory protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ESRP1
Synonyms (NCBI Gene) Gene synonyms aliases
DFNB109, RBM35A, RMB35A
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q22.1
Summary Summary of gene provided in NCBI Entrez Gene.
ESPR1 is an epithelial cell-type-specific splicing regulator (Warzecha et al., 2009 [PubMed 19285943]).[supplied by OMIM, Aug 2009]
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1554577339 ATGATAACACCGTAGTCAG>- Pathogenic Coding sequence variant, frameshift variant
rs1554577402 C>G Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016986 hsa-miR-335-5p Microarray 18185580
MIRT636556 hsa-miR-25-3p HITS-CLIP 23824327
MIRT636555 hsa-miR-32-5p HITS-CLIP 23824327
MIRT636554 hsa-miR-363-3p HITS-CLIP 23824327
MIRT636553 hsa-miR-367-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding IEA
GO:0003729 Function MRNA binding IBA
GO:0003729 Function MRNA binding IDA 19285943
GO:0003729 Function MRNA binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612959 25966 ENSG00000104413
Protein
UniProt ID Q6NXG1
Protein name Epithelial splicing regulatory protein 1 (RNA-binding motif protein 35A) (RNA-binding protein 35A)
Protein function mRNA splicing factor that regulates the formation of epithelial cell-specific isoforms. Specifically regulates the expression of FGFR2-IIIb, an epithelial cell-specific isoform of FGFR2. Also regulates the splicing of CD44, CTNND1, ENAH, 3 trans
PDB 2DHA , 2RVJ , 7VKI , 7VKJ , 7WRN
Family and domains
Tissue specificity TISSUE SPECIFICITY: Epithelial cell-specific. {ECO:0000269|PubMed:19285943}.
Sequence
MTASPDYLVVLFGITAGATGAKLGSDEKELILLFWKVVDLANKKVGQLHEVLVRPDQLEL
TEDCKEETKIDVESLSSASQLDQALRQFNQSVSNELNIGVGTSFCLCTDGQLHVRQILHP
EASKKNVLLPECFYSFFDLRKEFKKCCPGSPDIDKLDVATMTEYLNFEKSSSVSRYGASQ
VEDMGNIILAMISEPYNHRFSDPERVNYKFESGTCSKMELIDDNTVVRARGLPWQSSDQD
IARFFKGLNIAKGGAALCLNAQGRRNGEALVRFVSEEHRDLALQRHKHHMGTRYIEVYKA
TGEDFLKIAGGTSNEVAQFLSKENQVIVRMRGLPFTATAEEVVAFFGQHCPITGGKEGIL
FVTYPDGRPTGDAFVLFACEEYAQNALRKHKDLLGKRYIELFRSTAAEVQQVLNRFSSAP
LIPLPTPPIIPVLPQQFVPPTNVRDCIRLRGLPYAATIEDILDFLGEFATDIRTHGVHMV
LNHQGRPSGDAFIQMKSADRAFMAAQKCHKKNMKDRYVEVFQCSAEEMNFVLMGGTLNRN
GLSPPPCKLPCLSPPSYTFPAPAAVIPTEAAIYQPSVILNPRALQPSTAYYPAGTQLFMN
YTAYYPSPPGSPNSLGYFPTAANLSGVPPQPGTVVRMQGLAYNTGVKEILNFFQGYQYAT
EDGLIHTNDQARTLPKEWVCI
Sequence length 681
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Signaling by BRAF and RAF fusions
FGFR2 alternative splicing
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Hearing Loss Hearing loss, autosomal recessive 109 rs1554577339, rs1554577402 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes, Adipsin levels in type 2 diabetes N/A N/A GWAS
Hypertension Resistant hypertension N/A N/A GWAS
Prostate cancer Prostate cancer N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenomyosis Associate 37019419
Adie Syndrome Associate 38303513
Breast Neoplasms Associate 26646320, 27911856, 30042172, 30665944, 31755218, 35887187, 36925195
Breast Neoplasms Stimulate 34262011
Calcinosis Cutis Associate 25169209
Carcinogenesis Associate 31570856, 31963158, 32964032
Carcinoma Stimulate 34903603
Carcinoma Non Small Cell Lung Associate 20980099, 34342121
Carcinoma Renal Cell Associate 35876041
Cell Transformation Neoplastic Associate 31963158