ASPN (asporin)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
54829
Gene name Gene Name - the full gene name approved by the HGNC.
Asporin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ASPN
Synonyms (NCBI Gene) Gene synonyms aliases
OS3, PLAP-1, PLAP1, SLRR1C
Disease Acronyms (UniProt) Disease acronyms from UniProt database
OS3
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9q22.31
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a cartilage extracellular protein that is member of the small leucine-rich proteoglycan family. The encoded protein may regulate chondrogenesis by inhibiting transforming growth factor-beta 1-induced gene expression in cartilage. This pr
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all(6)
miRTarBase ID miRNA Experiments Reference
MIRT018748 hsa-miR-335-5p Microarray 18185580
MIRT023007 hsa-miR-124-3p Microarray 18668037
MIRT030089 hsa-miR-26b-5p Microarray 19088304
MIRT1937200 hsa-miR-3613-3p CLIP-seq
MIRT1937201 hsa-miR-371-5p CLIP-seq
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all(1)
Transcription factor Regulation Reference
SP1 Unknown 21528154
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all(10)
GO ID Ontology Definition Evidence Reference
GO:0005509 Function Calcium ion binding IDA 19589127
GO:0005518 Function Collagen binding IEA
GO:0005615 Component Extracellular space IBA 21873635
GO:0030021 Function Extracellular matrix structural constituent conferring compression resistance RCA 20551380, 25037231, 27068509, 27559042, 28675934
GO:0030282 Process Bone mineralization IDA 19589127
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
608135 14872 ENSG00000106819
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
UniProt ID Q9BXN1
Protein name Asporin (Periodontal ligament-associated protein 1) (PLAP-1)
Protein function Negatively regulates periodontal ligament (PDL) differentiation and mineralization to ensure that the PDL is not ossified and to maintain homeostasis of the tooth-supporting system. Inhibits BMP2-induced cytodifferentiation of PDL cells by preve
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01462 LRRNT 74 → 101 Leucine rich repeat N-terminal domain Family
PF13855 LRR_8 103 → 162 Leucine rich repeat Repeat
PF13855 LRR_8 241 → 301 Leucine rich repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Higher levels in osteoarthritic articular cartilage, aorta, uterus. Moderate expression in small intestine, heart, liver, bladder, ovary, stomach, and in the adrenal, thyroid, and mammary glands. Low expression in trachea, bone marrow,
Sequence 
MKEYVLLLFLALCSAKPFFSPSHIALKNMMLKDMEDTDDDDDDDDDDDDDDEDNSLFPTR
EPRSHFFPFDLFPMCPFGCQCYSRVVHCSDLGLTSVPTNIPFDTRMLDLQNNKIKEIKEN
DFKGLTSLYGLILNNNKLTKIHPKAFLTTKKLRRLYLSHNQLSEIPLNLPKSLAELRIHE
NKVKKIQKDTFKGMNALHVLEMSANPLDNNGIEPGAFEGVTVFHIRIAEAKLTSVPKGLP
PTLLELHLDYNKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENNK
LKKIPSGLPELKYLQIIFLHSNSIARVGVNDFCPTVPKMKKSLYSAISLFNNPVKYWEMQ
PATFRCVLSRMSVQLGNFGM
Sequence length 380
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Arthritis Degenerative polyarthritis rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470
Show/Hide Text Mining Associations (37)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Stimulate 22247499
Arthritis Associate 28651521
Atrial Fibrillation Associate 37967346
Breast Neoplasms Inhibit 27409832
Carpal Tunnel Syndrome Associate 37878141
Cartilage Diseases Associate 17827158
Colorectal Neoplasms Associate 25755742, 30728352
Developmental Dysplasia of the Hip Associate 21329514, 21542882
Endometrial Neoplasms Associate 36232772
Endometriosis Associate 36011263