Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	54820
Gene name Gene Name - the full gene name approved by the HGNC.	NudE neurodevelopment protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NDE1
Synonyms (NCBI Gene) Gene synonyms aliases	HOM-TES-87, LIS4, MHAC, NDE, NUDE, NUDE1
Chromosome Chromosome number	16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	16p13.11
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the nuclear distribution E (NudE) family of proteins. The encoded protein is localized at the centrosome and interacts with other centrosome components as part of a multiprotein complex that regulates dynein function. This pr

Show/Hide all(8)

SNP ID	Visualize variation	Clinical significance	Consequence
rs147174812	G>A	Conflicting-interpretations-of-pathogenicity, uncertain-significance, likely-benign	Intron variant
rs398123577	G>A	Pathogenic	Splice acceptor variant
rs576928842	C>A,G,T	Pathogenic	Missense variant, synonymous variant, stop gained, coding sequence variant
rs749768828	C>-,CC	Pathogenic	Frameshift variant, coding sequence variant
rs756206942	AC>-	Pathogenic	Frameshift variant, coding sequence variant
rs757604577	C>A,G,T	Pathogenic	Coding sequence variant, stop gained, synonymous variant, genic upstream transcript variant, missense variant
rs794727491	A>G	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, genic upstream transcript variant, missense variant, initiator codon variant
rs1456594953	G>T	Pathogenic	Genic upstream transcript variant, splice donor variant

Show/Hide all(130)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022760	hsa-miR-124-3p	Microarray	18668037
MIRT024682	hsa-miR-215-5p	Microarray	19074876
MIRT026541	hsa-miR-192-5p	Microarray	19074876
MIRT028581	hsa-miR-30a-5p	Proteomics	18668040
MIRT050211	hsa-miR-25-3p	CLASH	23622248
MIRT048631	hsa-miR-99a-5p	CLASH	23622248
MIRT048448	hsa-miR-100-5p	CLASH	23622248
MIRT047227	hsa-miR-181b-5p	CLASH	23622248
MIRT043877	hsa-miR-378a-3p	CLASH	23622248
MIRT043599	hsa-miR-151a-3p	CLASH	23622248
MIRT042463	hsa-miR-423-3p	CLASH	23622248
MIRT039461	hsa-miR-652-3p	CLASH	23622248
MIRT039149	hsa-miR-769-5p	CLASH	23622248
MIRT038356	hsa-miR-296-3p	CLASH	23622248
MIRT038035	hsa-miR-423-5p	CLASH	23622248
MIRT037795	hsa-miR-92b-5p	CLASH	23622248
MIRT037412	hsa-miR-744-5p	CLASH	23622248
MIRT037212	hsa-miR-877-5p	CLASH	23622248
MIRT052813	hsa-miR-3196	CLASH	23622248
MIRT1177863	hsa-miR-1261	CLIP-seq
MIRT1177864	hsa-miR-129-5p	CLIP-seq
MIRT1177865	hsa-miR-147	CLIP-seq
MIRT1177866	hsa-miR-204	CLIP-seq
MIRT1177867	hsa-miR-211	CLIP-seq
MIRT1177868	hsa-miR-2113	CLIP-seq
MIRT1177869	hsa-miR-3173-3p	CLIP-seq
MIRT1177870	hsa-miR-361-5p	CLIP-seq
MIRT1177871	hsa-miR-4428	CLIP-seq
MIRT1177872	hsa-miR-4521	CLIP-seq
MIRT1177873	hsa-miR-4755-5p	CLIP-seq
MIRT1177874	hsa-miR-490-5p	CLIP-seq
MIRT1177875	hsa-miR-498	CLIP-seq
MIRT1177876	hsa-miR-599	CLIP-seq
MIRT1177877	hsa-miR-623	CLIP-seq
MIRT1177878	hsa-miR-759	CLIP-seq
MIRT1177879	hsa-miR-1296	CLIP-seq
MIRT1177880	hsa-miR-140-3p	CLIP-seq
MIRT1177881	hsa-miR-2116	CLIP-seq
MIRT1177882	hsa-miR-3170	CLIP-seq
MIRT1177883	hsa-miR-3671	CLIP-seq
MIRT1177884	hsa-miR-4260	CLIP-seq
MIRT1177885	hsa-miR-4283	CLIP-seq
MIRT1177886	hsa-miR-4300	CLIP-seq
MIRT1177887	hsa-miR-4437	CLIP-seq
MIRT1177888	hsa-miR-4443	CLIP-seq
MIRT1177889	hsa-miR-4481	CLIP-seq
MIRT1177890	hsa-miR-4489	CLIP-seq
MIRT1177891	hsa-miR-4512	CLIP-seq
MIRT1177892	hsa-miR-4716-3p	CLIP-seq
MIRT1177893	hsa-miR-4723-5p	CLIP-seq
MIRT1177894	hsa-miR-4745-5p	CLIP-seq
MIRT1177895	hsa-miR-4797-5p	CLIP-seq
MIRT1177878	hsa-miR-759	CLIP-seq
MIRT1177896	hsa-miR-920	CLIP-seq
MIRT1177897	hsa-miR-939	CLIP-seq
MIRT2051473	hsa-miR-122	CLIP-seq
MIRT1177864	hsa-miR-129-5p	CLIP-seq
MIRT2051474	hsa-miR-1297	CLIP-seq
MIRT1177865	hsa-miR-147	CLIP-seq
MIRT1177868	hsa-miR-2113	CLIP-seq
MIRT2051475	hsa-miR-26a	CLIP-seq
MIRT2051476	hsa-miR-26b	CLIP-seq
MIRT1177882	hsa-miR-3170	CLIP-seq
MIRT2051477	hsa-miR-3659	CLIP-seq
MIRT2051478	hsa-miR-4266	CLIP-seq
MIRT2051479	hsa-miR-4465	CLIP-seq
MIRT2051480	hsa-miR-4466	CLIP-seq
MIRT1177876	hsa-miR-599	CLIP-seq
MIRT2051481	hsa-miR-675	CLIP-seq
MIRT2280501	hsa-miR-103a	CLIP-seq
MIRT2280502	hsa-miR-105	CLIP-seq
MIRT2280503	hsa-miR-107	CLIP-seq
MIRT2280504	hsa-miR-1245b-3p	CLIP-seq
MIRT1177864	hsa-miR-129-5p	CLIP-seq
MIRT2280505	hsa-miR-1322	CLIP-seq
MIRT1177865	hsa-miR-147	CLIP-seq
MIRT2280506	hsa-miR-1912	CLIP-seq
MIRT1177868	hsa-miR-2113	CLIP-seq
MIRT2280507	hsa-miR-3119	CLIP-seq
MIRT2280508	hsa-miR-3130-5p	CLIP-seq
MIRT2280509	hsa-miR-3140-3p	CLIP-seq
MIRT2280510	hsa-miR-3158-3p	CLIP-seq
MIRT1177882	hsa-miR-3170	CLIP-seq
MIRT2280511	hsa-miR-3171	CLIP-seq
MIRT2280512	hsa-miR-326	CLIP-seq
MIRT2280513	hsa-miR-330-5p	CLIP-seq
MIRT2280514	hsa-miR-3591-5p	CLIP-seq
MIRT1177870	hsa-miR-361-5p	CLIP-seq
MIRT2280515	hsa-miR-3646	CLIP-seq
MIRT1177886	hsa-miR-4300	CLIP-seq
MIRT1177888	hsa-miR-4443	CLIP-seq
MIRT2280516	hsa-miR-4446-3p	CLIP-seq
MIRT2280517	hsa-miR-4460	CLIP-seq
MIRT1177889	hsa-miR-4481	CLIP-seq
MIRT2280518	hsa-miR-4482	CLIP-seq
MIRT2280519	hsa-miR-450b-3p	CLIP-seq
MIRT2280520	hsa-miR-4654	CLIP-seq
MIRT2280521	hsa-miR-4661-3p	CLIP-seq
MIRT2280522	hsa-miR-4713-3p	CLIP-seq
MIRT1177892	hsa-miR-4716-3p	CLIP-seq
MIRT2280523	hsa-miR-4719	CLIP-seq
MIRT1177893	hsa-miR-4723-5p	CLIP-seq
MIRT2280524	hsa-miR-4727-3p	CLIP-seq
MIRT1177894	hsa-miR-4745-5p	CLIP-seq
MIRT2280525	hsa-miR-4769-5p	CLIP-seq
MIRT2280526	hsa-miR-4772-5p	CLIP-seq
MIRT2280527	hsa-miR-4777-3p	CLIP-seq
MIRT2280528	hsa-miR-545	CLIP-seq
MIRT1177876	hsa-miR-599	CLIP-seq
MIRT2280529	hsa-miR-638	CLIP-seq
MIRT1177878	hsa-miR-759	CLIP-seq
MIRT2280530	hsa-miR-769-3p	CLIP-seq
MIRT2280531	hsa-miR-875-5p	CLIP-seq
MIRT1177896	hsa-miR-920	CLIP-seq
MIRT1177897	hsa-miR-939	CLIP-seq
MIRT2578930	hsa-miR-1229	CLIP-seq
MIRT2578931	hsa-miR-1273f	CLIP-seq
MIRT2578932	hsa-miR-143	CLIP-seq
MIRT2578933	hsa-miR-2278	CLIP-seq
MIRT2280507	hsa-miR-3119	CLIP-seq
MIRT2280509	hsa-miR-3140-3p	CLIP-seq
MIRT2280510	hsa-miR-3158-3p	CLIP-seq
MIRT2578934	hsa-miR-342-3p	CLIP-seq
MIRT2578935	hsa-miR-4307	CLIP-seq
MIRT2578936	hsa-miR-4632	CLIP-seq
MIRT2578937	hsa-miR-4649-5p	CLIP-seq
MIRT2578938	hsa-miR-4708-5p	CLIP-seq
MIRT2578939	hsa-miR-4717-3p	CLIP-seq
MIRT2578940	hsa-miR-4770	CLIP-seq
MIRT2280526	hsa-miR-4772-5p	CLIP-seq

Show/Hide all(53)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000132	Process	Establishment of mitotic spindle orientation	IBA
GO:0000132	Process	Establishment of mitotic spindle orientation	IMP	19468067
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000776	Component	Kinetochore	IBA
GO:0000776	Component	Kinetochore	IDA	17600710
GO:0000776	Component	Kinetochore	IEA
GO:0001764	Process	Neuron migration	IEA
GO:0005515	Function	Protein binding	IPI	16682949, 17600710, 22843697, 25332407, 29961565, 31413325, 33961781, 35271311
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IBA
GO:0005813	Component	Centrosome	IDA	21399614, 21529752
GO:0005813	Component	Centrosome	IEA
GO:0005815	Component	Microtubule organizing center	IEA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005871	Component	Kinesin complex	IBA
GO:0005874	Component	Microtubule	IEA
GO:0007020	Process	Microtubule nucleation	IBA
GO:0007020	Process	Microtubule nucleation	IEA
GO:0007059	Process	Chromosome segregation	IBA
GO:0007100	Process	Mitotic centrosome separation	IBA
GO:0007399	Process	Nervous system development	IEA
GO:0007405	Process	Neuroblast proliferation	IEA
GO:0008017	Function	Microtubule binding	IBA
GO:0008017	Function	Microtubule binding	IEA
GO:0008017	Function	Microtubule binding	ISS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IBA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0021987	Process	Cerebral cortex development	IEA
GO:0021987	Process	Cerebral cortex development	IMP	21529752
GO:0030154	Process	Cell differentiation	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0030900	Process	Forebrain development	IEA
GO:0031023	Process	Microtubule organizing center organization	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031616	Component	Spindle pole centrosome	IEA
GO:0031616	Component	Spindle pole centrosome	ISS
GO:0032154	Component	Cleavage furrow	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	22843697
GO:0045202	Component	Synapse	IEA
GO:0047496	Process	Vesicle transport along microtubule	IBA
GO:0047496	Process	Vesicle transport along microtubule	IEA
GO:0050000	Process	Chromosome localization	IBA
GO:0050000	Process	Chromosome localization	IMP	17600710
GO:0051298	Process	Centrosome duplication	IEA
GO:0051298	Process	Centrosome duplication	ISS
GO:0051301	Process	Cell division	IEA
GO:0051642	Process	Centrosome localization	IBA

MIM	HGNC	e!Ensembl
609449	17619	ENSG00000072864

Protein

UniProt ID

Q9NXR1

Protein name

Nuclear distribution protein nudE homolog 1 (NudE)

Protein function

Required for centrosome duplication and formation and function of the mitotic spindle. Essential for the development of the cerebral cortex. May regulate the production of neurons by controlling the orientation of the mitotic spindle during divi

PDB

7E1T

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04880	NUDE_C	134 → 312	NUDE protein, C-terminal conserved region	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in the neuroepithelium throughout the developing brain, including the cerebral cortex and cerebellum. {ECO:0000269|PubMed:21529752}.

Sequence

MEDSGKTFSSEEEEANYWKDLAMTYKQRAENTQEELREFQEGSREYEAELETQLQQIETR
NRDLLSENNRLRMELETIKEKFEVQHSEGYRQISALEDDLAQTKAIKDQLQKYIRELEQA
NDDLERAKRATIMSLEDFEQRLNQAIERNAFLESELDEKENLLESVQRLKDEARDLRQEL
AVQQKQEKPRTPMPSSVEAERTDTAVQATGSVPSTPIAHRGPSSSLNTPGSFRRGLDDST
GGTPLTPAARISALNIVGDLLRKVGALESKLASCRNLVYDQSPNRTGGPASGRSSKNRDG
GERRPSSTSVPLGDKGLDTSCRWLSKSTTRSSSSC

Sequence length

335

Interactions

View interactions

	Reactome
			Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal Separation of Sister Chromatids Resolution of Sister Chromatid Cohesion Regulation of PLK1 Activity at G2/M Transition Loss of Nlp from mitotic centrosomes Recruitment of mitotic centrosome proteins and complexes Loss of proteins required for interphase microtubule organization from the centrosome Recruitment of NuMA to mitotic centrosomes Anchoring of the basal body to the plasma membrane RHO GTPases Activate Formins Mitotic Prometaphase AURKA Activation by TPX2 EML4 and NUDC in mitotic spindle formation

Show/Hide Causal Diseases (2)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Lissencephaly	lissencephaly 4	rs756206942, rs749768828, rs576928842, rs1456594953, rs757604577	N/A
Microhydranencephaly	nde1-related microhydranencephaly	rs756206942	N/A

Show/Hide Unknown Diseases (4)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Hydranencephaly	hydranencephaly	N/A	N/A	GenCC
Mental retardation	intellectual disability	N/A	N/A	ClinVar
Microlissencephaly	microlissencephaly	N/A	N/A	GenCC
Psoriasis	Psoriasis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (19)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Alcoholism	Associate	19786961
Alzheimer Disease	Associate	34981809
Behcet Syndrome	Associate	25332407
Bernard Soulier Syndrome	Associate	23704059
Depressive Disorder	Associate	19300510
Disease	Associate	21853134
Dyslexia	Associate	19786961
Epilepsy Familial Mesial Temporal Lobe	Associate	22523559
Fetal Diseases	Associate	23704059
Glioma	Associate	37349788
Hippocampal Sclerosis	Associate	22523559
Lissencephaly	Associate	38194050
Macular dystrophy corneal type 1	Associate	38194050
Malformations of Cortical Development	Associate	38194050
Mental Disorders	Associate	25332407, 29142105
Microcephaly	Associate	23704059, 24098143
Psychotic Disorders	Associate	19300510
Sarcoma Kaposi	Associate	38194050
Schizophrenia	Associate	19251251, 25332407, 26350705, 29142105

NDE1 (nudE neurodevelopment protein 1)