Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
54815
Gene name Gene Name - the full gene name approved by the HGNC.
GATA zinc finger domain containing 2A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GATAD2A
Synonyms (NCBI Gene) Gene synonyms aliases
p66alpha
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.11
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT025615 hsa-miR-10a-5p Sequencing 20371350
MIRT027021 hsa-miR-103a-3p Sequencing 20371350
MIRT027485 hsa-miR-98-5p Microarray 19088304
MIRT031446 hsa-miR-16-5p Sequencing 20371350
MIRT049559 hsa-miR-92a-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0005515 Function Protein binding IPI 12183469, 16415179, 25416956, 25753662, 26030138, 27732854, 32296183, 32814053, 33961781, 35916866
GO:0005634 Component Nucleus IDA 12183469, 27732854, 28977666, 33283408
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
614997 29989 ENSG00000167491
Protein
UniProt ID Q86YP4
Protein name Transcriptional repressor p66-alpha (Hp66alpha) (GATA zinc finger domain-containing protein 2A)
Protein function Transcriptional repressor (PubMed:12183469, PubMed:16415179). Acts as a component of the histone deacetylase NuRD complex which participates in the remodeling of chromatin (PubMed:16428440, PubMed:28977666). Enhances MBD2-mediated repression (Pu
PDB 2L2L
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16563 P66_CC 136 179 Coiled-coil and interaction region of P66A and P66B with MBD2 Coiled-coil
PF00320 GATA 417 451 GATA zinc finger Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous, both in fetal and adult tissues. {ECO:0000269|PubMed:12183469}.
Sequence
MTEEACRTRSQKRALERDPTEDDVESKKIKMERGLLASDLNTDGDMRVTPEPGAGPTQGL
LRATEATAMAMGRGEGLVGDGPVDMRTSHSDMKSERRPPSPDVIVLSDNEQPSSPRVNGL
TTVALKETSTEALMKSSPEERERMIKQLKEELRLEEAKLVLLKKLRQSQIQKEATAQKPT
GSVGSTVTTPPPLVRGTQNIPAGKPSLQTSSARMPGSVIPPPLVRGGQQASSKLGPQASS
QVVMPPLVRGAQQIHSIRQHSSTGPPPLLLAPRASVPSVQIQGQRIIQQGLIRVANVPNT
SLLVNIPQPTPASLKGTTATSAQANSTPTSVASVVTSAESPASRQAAAKLALRKQLEKTL
LEIPPPKPPAPEMNFLPSAANNEFIYLVGLEEVVQNLLETQGRMSAATVLSREPYMCAQC
KTDFTCRWREEKSGAIMCENCMTTNQKKALK
VEHTSRLKAAFVKALQQEQEIEQRLLQQG
TAPAQAKAEPTAAPHPVLKQVIKPRRKLAFRSGEARDWSNGAVLQASSQLSRGSATTPRG
VLHTFSPSPKLQNSASATALVSRTGRHSERTVSAGKGSATSNWKKTPLSTGGTLAFVSPS
LAVHKSSSAVDRQREYLLDMIPPRSIPQSATWK
Sequence length 633
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  ATP-dependent chromatin remodeling   HDACs deacetylate histones
Regulation of TP53 Activity through Acetylation
RNA Polymerase I Transcription Initiation
Regulation of PTEN gene transcription
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or gastroesophageal reflux disease, Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Breast Cancer Breast cancer N/A N/A GWAS
Diabetes Type 2 diabetes (PheCode 250.2), Type 2 diabetes or schizophrenia (pleiotropy), Type 2 diabetes, Mild age-related type 2 diabetes N/A N/A GWAS
Dyslexia Dyslexia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 35441736
Brain Diseases Associate 37181331
Breast Neoplasms Associate 32934226
Developmental Disabilities Associate 37181331
Facial Pain Associate 37181331
Fatty Liver Associate 35881683
Infections Associate 30955816
Malignant hyperthermia susceptibility type 4 Associate 29385134
Neoplasm Metastasis Associate 35904180
Neoplasms Associate 27432226, 33963205