GATAD2A (GATA zinc finger domain containing 2A)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 54815
Gene name GATA zinc finger domain containing 2A
Gene symbol GATAD2A
Synonyms (NCBI Gene)
p66alpha
Chromosome 19
Chromosome location 19p13.11
miRNA miRNA information provided by mirtarbase database.
1031
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (1031)
miRTarBase ID miRNA Experiments Reference
MIRT025615 hsa-miR-10a-5p Sequencing 20371350
MIRT027021 hsa-miR-103a-3p Sequencing 20371350
MIRT027485 hsa-miR-98-5p Microarray 19088304
MIRT031446 hsa-miR-16-5p Sequencing 20371350
MIRT049559 hsa-miR-92a-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (22)
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0005515 Function Protein binding IPI 12183469, 16415179, 25416956, 25753662, 26030138, 27732854, 32296183, 32814053, 33961781, 35916866
GO:0005634 Component Nucleus IDA 12183469, 27732854, 28977666, 33283408
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
614997 29989 ENSG00000167491
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q86YP4
Protein name Transcriptional repressor p66-alpha (Hp66alpha) (GATA zinc finger domain-containing protein 2A)
Protein function Transcriptional repressor (PubMed:12183469, PubMed:16415179). Acts as a component of the histone deacetylase NuRD complex which participates in the remodeling of chromatin (PubMed:16428440, PubMed:28977666). Enhances MBD2-mediated repression (Pu
PDB 2L2L
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16563 P66_CC 136 → 179 Coiled-coil and interaction region of P66A and P66B with MBD2 Coiled-coil
PF00320 GATA 417 → 451 GATA zinc finger Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous, both in fetal and adult tissues. {ECO:0000269|PubMed:12183469}.
Sequence 
MTEEACRTRSQKRALERDPTEDDVESKKIKMERGLLASDLNTDGDMRVTPEPGAGPTQGL
LRATEATAMAMGRGEGLVGDGPVDMRTSHSDMKSERRPPSPDVIVLSDNEQPSSPRVNGL
TTVALKETSTEALMKSSPEERERMIKQLKEELRLEEAKLVLLKKLRQSQIQKEATAQKPT
GSVGSTVTTPPPLVRGTQNIPAGKPSLQTSSARMPGSVIPPPLVRGGQQASSKLGPQASS
QVVMPPLVRGAQQIHSIRQHSSTGPPPLLLAPRASVPSVQIQGQRIIQQGLIRVANVPNT
SLLVNIPQPTPASLKGTTATSAQANSTPTSVASVVTSAESPASRQAAAKLALRKQLEKTL
LEIPPPKPPAPEMNFLPSAANNEFIYLVGLEEVVQNLLETQGRMSAATVLSREPYMCAQC
KTDFTCRWREEKSGAIMCENCMTTNQKKALKVEHTSRLKAAFVKALQQEQEIEQRLLQQG
TAPAQAKAEPTAAPHPVLKQVIKPRRKLAFRSGEARDWSNGAVLQASSQLSRGSATTPRG
VLHTFSPSPKLQNSASATALVSRTGRHSERTVSAGKGSATSNWKKTPLSTGGTLAFVSPS
LAVHKSSSAVDRQREYLLDMIPPRSIPQSATWK
Sequence length 633
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  ATP-dependent chromatin remodeling   HDACs deacetylate histones
Regulation of TP53 Activity through Acetylation
RNA Polymerase I Transcription Initiation
Regulation of PTEN gene transcription
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
6
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
GATAD2A-associated neurodevelopmental disorder Likely pathogenic rs2513830025 RCV002284129
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Neurodevelopmental disorder Uncertain significance rs2513697772 RCV003994718
Show/Hide Text Mining Associations (19)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 35441736
Brain Diseases Associate 37181331
Breast Neoplasms Associate 32934226
Developmental Disabilities Associate 37181331
Facial Pain Associate 37181331
Fatty Liver Associate 35881683
Infections Associate 30955816
Malignant hyperthermia susceptibility type 4 Associate 29385134
Neoplasm Metastasis Associate 35904180
Neoplasms Associate 27432226, 33963205