Gene Gene information from NCBI Gene database.
Entrez ID 5473
Gene name Pro-platelet basic protein
Gene symbol PPBP
Synonyms (NCBI Gene)
B-TG1Beta-TGCTAP-IIICTAP3CTAPIIICXCL7LA-PF4LDGFMDGFNAP-2PBPSCYB7TC1TC2TGBTGB1THBGBTHBGB1
Chromosome 4
Chromosome location 4q13.3
Summary The protein encoded by this gene is a platelet-derived growth factor that belongs to the CXC chemokine family. This growth factor is a potent chemoattractant and activator of neutrophils. It has been shown to stimulate various cellular processes including
miRNA miRNA information provided by mirtarbase database.
10
miRTarBase ID miRNA Experiments Reference
MIRT018016 hsa-miR-335-5p Microarray 18185580
MIRT1252237 hsa-miR-101 CLIP-seq
MIRT1252238 hsa-miR-1257 CLIP-seq
MIRT1252239 hsa-miR-144 CLIP-seq
MIRT1252240 hsa-miR-331-5p CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
TBP Unknown 7958954
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
27
GO ID Ontology Definition Evidence Reference
GO:0005125 Function Cytokine activity IEA
GO:0005515 Function Protein binding IPI 28381538, 32814053
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
121010 9240 ENSG00000163736
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P02775
Protein name Platelet basic protein (PBP) (C-X-C motif chemokine 7) (Leukocyte-derived growth factor) (LDGF) (Macrophage-derived growth factor) (MDGF) (Small-inducible cytokine B7) [Cleaved into: Connective tissue-activating peptide III (CTAP-III) (LA-PF4) (Low-affini
Protein function LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen act
PDB 1F9P , 1NAP , 1TVX
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00048 IL8 61 119 Small cytokines (intecrine/chemokine), interleukin-8 like Domain
Sequence
MSLRLDTTPSCNSARPLHALQVLLLLSLLLTALASSTKGQTKRNLAKGKEESLDSDLYAE
LRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKK
LAGDESAD
Sequence length 128
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
  Platelet degranulation
Chemokine receptors bind chemokines
G alpha (i) signalling events
Neutrophil degranulation