NECAB2 (N-terminal EF-hand calcium binding protein 2)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
54550
Gene name Gene Name - the full gene name approved by the HGNC.
N-terminal EF-hand calcium binding protein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NECAB2
Synonyms (NCBI Gene) Gene synonyms aliases
EFCBP2, stip-2
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16q23.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a neuronal calcium-binding protein that binds to and modulates the function of at least two receptors, adenosine A(2A) receptor and metabotropic glutamate receptor type 5. [provided by RefSeq, Jul 2016]
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(13)
miRTarBase ID miRNA Experiments Reference
MIRT1179473 hsa-miR-3194-3p CLIP-seq
MIRT1179474 hsa-miR-3661 CLIP-seq
MIRT1179475 hsa-miR-492 CLIP-seq
MIRT1179476 hsa-miR-631 CLIP-seq
MIRT1179477 hsa-miR-885-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(14)
GO ID Ontology Definition Evidence Reference
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 17689978, 19694902
GO:0005737 Component Cytoplasm IBA 21873635
GO:0005886 Component Plasma membrane IDA 19694902
GO:0030424 Component Axon IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
618130 23746 ENSG00000103154
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q7Z6G3
Protein name N-terminal EF-hand calcium-binding protein 2 (EF-hand calcium-binding protein 2) (Neuronal calcium-binding protein 2) (Synaptotagmin-interacting protein 2) (Stip-2)
Protein function May act as a signaling scaffold protein that senses intracellular calcium. Can modulate ligand-induced internalization of ADORA2A and coupling efficiency of mGluR5/GRM5; for both receptors may regulate signaling activity such as promoting MAPK1/
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13833 EF-hand_8 64 → 92 EF-hand domain pair Domain
PF13833 EF-hand_8 89 → 126 EF-hand domain pair Domain
PF03992 ABM 286 → 360 Antibiotic biosynthesis monooxygenase Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in brain. Expressed in the spinal dorsal horn with especially strong expression in lamina IIi; found in excitory synaptic boutons and in ependymal cells (at protein level). {ECO:0000269|PubMed:12044471, ECO:0000269|PubMed:268
Sequence 
MCERAARLCRAGAHRLLREPPQQGRALGGLLRWVGARMGEPRESLAPAAPADPGPASPRG
GTAVILDIFRRADKNDDGKLSLEEFQLFFADGVLNEKELEDLFHTIDSDNTNHVDTKELC
DYFVDHMGDYEDVLASLETLNHSVLKAMGYTKKVYEGGSNVDQFVTRFLLKETANQIQSL
LSSVESAVEAIEEQTSQLRQNHIKPSHSAAQTWCGSPTPASAPNHKLMAMEQGKTLPSAT
EDAKEEGLEAQISRLAELIGRLESKALWFDLQQRLSDEDGTNMHLQLVRQEMAVCPEQLS
EFLDSLRQYLRGTTGVRNCFHITAVRLSDGFTFVIYEFWETEEAWKRHLQSPLCKAFRHV
KVDTLSQPEALSRILVPAAWCTVGRD
Sequence length 386
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Rheumatoid arthritis Rheumatoid Arthritis rs587776843 30891314
Show/Hide Text Mining Associations (2)
Associations from Text Mining
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 34664394
Neoplastic Cells Circulating Associate 34664394