NECAB2 (N-terminal EF-hand calcium binding protein 2)

Gene

• Entrez ID: 54550
• Gene name: N-terminal EF-hand calcium binding protein 2
• Gene symbol: NECAB2
• Synonyms (NCBI Gene): EFCBP2, stip-2
• Chromosome: 16
• Chromosome location: 16q23.3
• Summary: The protein encoded by this gene is a neuronal calcium-binding protein that binds to and modulates the function of at least two receptors, adenosine A(2A) receptor and metabotropic glutamate receptor type 5. [provided by RefSeq, Jul 2016]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1179473	hsa-miR-3194-3p	CLIP-seq
MIRT1179474	hsa-miR-3661	CLIP-seq
MIRT1179475	hsa-miR-492	CLIP-seq
MIRT1179476	hsa-miR-631	CLIP-seq
MIRT1179477	hsa-miR-885-3p	CLIP-seq
MIRT2051868	hsa-miR-1207-5p	CLIP-seq
MIRT2051869	hsa-miR-3127-3p	CLIP-seq
MIRT2051870	hsa-miR-3616-3p	CLIP-seq
MIRT2051871	hsa-miR-4302	CLIP-seq
MIRT2051872	hsa-miR-4436b-3p	CLIP-seq
MIRT2051873	hsa-miR-4455	CLIP-seq
MIRT2051874	hsa-miR-4697-3p	CLIP-seq
MIRT2051875	hsa-miR-4763-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	17689978, 19694902, 25416956, 27107012, 32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IDA	19694902
GO:0005886	Component	Plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0030424	Component	Axon	IEA
GO:0030425	Component	Dendrite	IEA
GO:0031687	Function	A2A adenosine receptor binding	IDA	17689978
GO:0031802	Function	Type 5 metabotropic glutamate receptor binding	IDA	19694902
GO:0042802	Function	Identical protein binding	IPI	25416956, 27107012, 32296183
GO:0042984	Process	Regulation of amyloid precursor protein biosynthetic process	IBA
GO:0042995	Component	Cell projection	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0060168	Process	Positive regulation of adenosine receptor signaling pathway	IDA	17689978
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	19694902
GO:0098793	Component	Presynapse	IEA
GO:0098794	Component	Postsynapse	IEA
GO:1900451	Process	Positive regulation of glutamate receptor signaling pathway	IDA	19694902
GO:1904021	Process	Negative regulation of G protein-coupled receptor internalization	IDA	17689978
GO:1905477	Process	Positive regulation of protein localization to membrane	IDA	19694902

Other IDs

• MIM: 618130
• HGNC: 23746
• e!Ensembl: ENSG00000103154

Protein

• UniProt ID: Q7Z6G3
• Protein name: N-terminal EF-hand calcium-binding protein 2 (EF-hand calcium-binding protein 2) (Neuronal calcium-binding protein 2) (Synaptotagmin-interacting protein 2) (Stip-2)
• Protein function: May act as a signaling scaffold protein that senses intracellular calcium. Can modulate ligand-induced internalization of ADORA2A and coupling efficiency of mGluR5/GRM5; for both receptors may regulate signaling activity such as promoting MAPK1/
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13833	EF-hand_8	64 → 92	EF-hand domain pair	Domain
  PF13833	EF-hand_8	89 → 126	EF-hand domain pair	Domain
  PF03992	ABM	286 → 360	Antibiotic biosynthesis monooxygenase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in brain. Expressed in the spinal dorsal horn with especially strong expression in lamina IIi; found in excitory synaptic boutons and in ependymal cells (at protein level). {ECO:0000269|PubMed:12044471, ECO:0000269|PubMed:268
• Sequence:

  MCERAARLCRAGAHRLLREPPQQGRALGGLLRWVGARMGEPRESLAPAAPADPGPASPRG
  GTAVILDIFRRADKNDDGKLSLEEFQLFFADGVLNEKELEDLFHTIDSDNTNHVDTKELC
  DYFVDHMGDYEDVLASLETLNHSVLKAMGYTKKVYEGGSNVDQFVTRFLLKETANQIQSL
  LSSVESAVEAIEEQTSQLRQNHIKPSHSAAQTWCGSPTPASAPNHKLMAMEQGKTLPSAT
  EDAKEEGLEAQISRLAELIGRLESKALWFDLQQRLSDEDGTNMHLQLVRQEMAVCPEQLS
  EFLDSLRQYLRGTTGVRNCFHITAVRLSDGFTFVIYEFWETEEAWKRHLQSPLCKAFRHV
  KVDTLSQPEALSRILVPAAWCTVGRD

• Sequence length: 386