Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	54550
Gene name Gene Name - the full gene name approved by the HGNC.	N-terminal EF-hand calcium binding protein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NECAB2
Synonyms (NCBI Gene) Gene synonyms aliases	EFCBP2, stip-2
Chromosome Chromosome number	16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	16q23.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a neuronal calcium-binding protein that binds to and modulates the function of at least two receptors, adenosine A(2A) receptor and metabotropic glutamate receptor type 5. [provided by RefSeq, Jul 2016]

Show/Hide all(13)

miRTarBase ID	miRNA	Experiments
MIRT1179473	hsa-miR-3194-3p	CLIP-seq
MIRT1179474	hsa-miR-3661	CLIP-seq
MIRT1179475	hsa-miR-492	CLIP-seq
MIRT1179476	hsa-miR-631	CLIP-seq
MIRT1179477	hsa-miR-885-3p	CLIP-seq
MIRT2051868	hsa-miR-1207-5p	CLIP-seq
MIRT2051869	hsa-miR-3127-3p	CLIP-seq
MIRT2051870	hsa-miR-3616-3p	CLIP-seq
MIRT2051871	hsa-miR-4302	CLIP-seq
MIRT2051872	hsa-miR-4436b-3p	CLIP-seq
MIRT2051873	hsa-miR-4455	CLIP-seq
MIRT2051874	hsa-miR-4697-3p	CLIP-seq
MIRT2051875	hsa-miR-4763-3p	CLIP-seq

Show/Hide all(22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	17689978, 19694902, 25416956, 27107012, 32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IDA	19694902
GO:0005886	Component	Plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0030424	Component	Axon	IEA
GO:0030425	Component	Dendrite	IEA
GO:0031687	Function	A2A adenosine receptor binding	IDA	17689978
GO:0031802	Function	Type 5 metabotropic glutamate receptor binding	IDA	19694902
GO:0042802	Function	Identical protein binding	IPI	25416956, 27107012, 32296183
GO:0042984	Process	Regulation of amyloid precursor protein biosynthetic process	IBA
GO:0042995	Component	Cell projection	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0060168	Process	Positive regulation of adenosine receptor signaling pathway	IDA	17689978
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	19694902
GO:0098793	Component	Presynapse	IEA
GO:0098794	Component	Postsynapse	IEA
GO:1900451	Process	Positive regulation of glutamate receptor signaling pathway	IDA	19694902
GO:1904021	Process	Negative regulation of G protein-coupled receptor internalization	IDA	17689978
GO:1905477	Process	Positive regulation of protein localization to membrane	IDA	19694902

MIM	HGNC	e!Ensembl
618130	23746	ENSG00000103154

Protein

UniProt ID

Q7Z6G3

Protein name

N-terminal EF-hand calcium-binding protein 2 (EF-hand calcium-binding protein 2) (Neuronal calcium-binding protein 2) (Synaptotagmin-interacting protein 2) (Stip-2)

Protein function

May act as a signaling scaffold protein that senses intracellular calcium. Can modulate ligand-induced internalization of ADORA2A and coupling efficiency of mGluR5/GRM5; for both receptors may regulate signaling activity such as promoting MAPK1/

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13833	EF-hand_8	64 → 92	EF-hand domain pair	Domain
PF13833	EF-hand_8	89 → 126	EF-hand domain pair	Domain
PF03992	ABM	286 → 360	Antibiotic biosynthesis monooxygenase	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain. Expressed in the spinal dorsal horn with especially strong expression in lamina IIi; found in excitory synaptic boutons and in ependymal cells (at protein level). {ECO:0000269|PubMed:12044471, ECO:0000269|PubMed:268

Sequence

MCERAARLCRAGAHRLLREPPQQGRALGGLLRWVGARMGEPRESLAPAAPADPGPASPRG
GTAVILDIFRRADKNDDGKLSLEEFQLFFADGVLNEKELEDLFHTIDSDNTNHVDTKELC
DYFVDHMGDYEDVLASLETLNHSVLKAMGYTKKVYEGGSNVDQFVTRFLLKETANQIQSL
LSSVESAVEAIEEQTSQLRQNHIKPSHSAAQTWCGSPTPASAPNHKLMAMEQGKTLPSAT
EDAKEEGLEAQISRLAELIGRLESKALWFDLQQRLSDEDGTNMHLQLVRQEMAVCPEQLS
EFLDSLRQYLRGTTGVRNCFHITAVRLSDGFTFVIYEFWETEEAWKRHLQSPLCKAFRHV
KVDTLSQPEALSRILVPAAWCTVGRD

Sequence length

386

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Rheumatoid arthritis	Rheumatoid arthritis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Carcinoma Hepatocellular	Associate	34664394
Neoplastic Cells Circulating	Associate	34664394

NECAB2 (N-terminal EF-hand calcium binding protein 2)