Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	54361
Gene name	Wnt family member 4
Gene symbol	WNT4
Synonyms (NCBI Gene)	SERKALWNT-4
Chromosome	1
Chromosome location	1p36.12
Summary	The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryog

Show/Hide all (3)

SNP ID	Visualize variation	Clinical significance	Consequence
rs121908650	T>C	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant
rs121908651	G>A	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant
rs121908652	G>A	Pathogenic	Missense variant, coding sequence variant

209

Show/Hide all (209)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006385	hsa-miR-29c-3p	Luciferase reporter assay	21436257
MIRT006385	hsa-miR-29c-3p	Luciferase reporter assay	21436257
MIRT006385	hsa-miR-29c-3p	Luciferase reporter assay	21436257
MIRT438738	hsa-miR-16-5p	qRT-PCRWestern blotYFP expression	24130753
MIRT438608	hsa-miR-24-3p	Luciferase reporter assay	23027131
MIRT438738	hsa-miR-16-5p	qRT-PCRWestern blotYFP expression	24130753
MIRT438608	hsa-miR-24-3p	Luciferase reporter assay	23027131
MIRT651521	hsa-miR-129-1-3p	HITS-CLIP	19536157
MIRT651520	hsa-miR-129-2-3p	HITS-CLIP	19536157
MIRT724146	hsa-miR-6892-3p	HITS-CLIP	19536157
MIRT724145	hsa-miR-2276-5p	HITS-CLIP	19536157
MIRT651519	hsa-miR-3183	HITS-CLIP	19536157
MIRT651518	hsa-miR-4723-3p	HITS-CLIP	19536157
MIRT651517	hsa-miR-6769b-3p	HITS-CLIP	19536157
MIRT724144	hsa-miR-4469	HITS-CLIP	19536157
MIRT724143	hsa-miR-6814-3p	HITS-CLIP	19536157
MIRT724142	hsa-miR-6872-5p	HITS-CLIP	19536157
MIRT651516	hsa-miR-3615	HITS-CLIP	19536157
MIRT651514	hsa-miR-7110-3p	HITS-CLIP	19536157
MIRT651515	hsa-miR-6817-3p	HITS-CLIP	19536157
MIRT724141	hsa-miR-3124-3p	HITS-CLIP	19536157
MIRT724140	hsa-miR-642a-5p	HITS-CLIP	19536157
MIRT724139	hsa-miR-4691-5p	HITS-CLIP	19536157
MIRT724138	hsa-miR-6792-3p	HITS-CLIP	19536157
MIRT724137	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT651513	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT651510	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT724136	hsa-miR-1238-3p	HITS-CLIP	19536157
MIRT627293	hsa-miR-4328	HITS-CLIP	23824327
MIRT627288	hsa-miR-4455	HITS-CLIP	23824327
MIRT627292	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT627291	hsa-miR-30a-3p	HITS-CLIP	23824327
MIRT627290	hsa-miR-30d-3p	HITS-CLIP	23824327
MIRT627289	hsa-miR-30e-3p	HITS-CLIP	23824327
MIRT627287	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT627293	hsa-miR-4328	HITS-CLIP	23824327
MIRT627291	hsa-miR-30a-3p	HITS-CLIP	23824327
MIRT627290	hsa-miR-30d-3p	HITS-CLIP	23824327
MIRT627289	hsa-miR-30e-3p	HITS-CLIP	23824327
MIRT651523	hsa-miR-548an	HITS-CLIP	23824327
MIRT651522	hsa-miR-124-3p	HITS-CLIP	23824327
MIRT651521	hsa-miR-129-1-3p	HITS-CLIP	23824327
MIRT651520	hsa-miR-129-2-3p	HITS-CLIP	23824327
MIRT651519	hsa-miR-3183	HITS-CLIP	23824327
MIRT651518	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT651517	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT651516	hsa-miR-3615	HITS-CLIP	23824327
MIRT651514	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT651515	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT651513	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT651512	hsa-miR-518a-5p	HITS-CLIP	23824327
MIRT651511	hsa-miR-527	HITS-CLIP	23824327
MIRT651510	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT627293	hsa-miR-4328	HITS-CLIP	23824327
MIRT627292	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT627291	hsa-miR-30a-3p	HITS-CLIP	23824327
MIRT627290	hsa-miR-30d-3p	HITS-CLIP	23824327
MIRT627289	hsa-miR-30e-3p	HITS-CLIP	23824327
MIRT627288	hsa-miR-4455	HITS-CLIP	23824327
MIRT627287	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT732019	hsa-miR-129-5p	Luciferase reporter assayWestern blot	27556296
MIRT732019	hsa-miR-129-5p	Luciferase reporter assayWestern blot	27556296
MIRT627291	hsa-miR-30a-3p	HITS-CLIP	27418678
MIRT627290	hsa-miR-30d-3p	HITS-CLIP	27418678
MIRT627289	hsa-miR-30e-3p	HITS-CLIP	27418678
MIRT627293	hsa-miR-4328	HITS-CLIP	27418678
MIRT627288	hsa-miR-4455	HITS-CLIP	27418678
MIRT627287	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT627292	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT735770	hsa-miR-1-3p	Luciferase reporter assayWestern blottingqRT-PCR	31814903
MIRT651521	hsa-miR-129-1-3p	HITS-CLIP	19536157
MIRT651520	hsa-miR-129-2-3p	HITS-CLIP	19536157
MIRT724146	hsa-miR-6892-3p	HITS-CLIP	19536157
MIRT724145	hsa-miR-2276-5p	HITS-CLIP	19536157
MIRT651519	hsa-miR-3183	HITS-CLIP	19536157
MIRT651518	hsa-miR-4723-3p	HITS-CLIP	19536157
MIRT651517	hsa-miR-6769b-3p	HITS-CLIP	19536157
MIRT724144	hsa-miR-4469	HITS-CLIP	19536157
MIRT724143	hsa-miR-6814-3p	HITS-CLIP	19536157
MIRT724142	hsa-miR-6872-5p	HITS-CLIP	19536157
MIRT651516	hsa-miR-3615	HITS-CLIP	19536157
MIRT651514	hsa-miR-7110-3p	HITS-CLIP	19536157
MIRT651515	hsa-miR-6817-3p	HITS-CLIP	19536157
MIRT724141	hsa-miR-3124-3p	HITS-CLIP	19536157
MIRT724140	hsa-miR-642a-5p	HITS-CLIP	19536157
MIRT724139	hsa-miR-4691-5p	HITS-CLIP	19536157
MIRT724138	hsa-miR-6792-3p	HITS-CLIP	19536157
MIRT724137	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT651513	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT651510	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT724136	hsa-miR-1238-3p	HITS-CLIP	19536157
MIRT627293	hsa-miR-4328	HITS-CLIP	23824327
MIRT627288	hsa-miR-4455	HITS-CLIP	23824327
MIRT627292	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT627291	hsa-miR-30a-3p	HITS-CLIP	23824327
MIRT627290	hsa-miR-30d-3p	HITS-CLIP	23824327
MIRT627289	hsa-miR-30e-3p	HITS-CLIP	23824327
MIRT627287	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT627293	hsa-miR-4328	HITS-CLIP	23824327
MIRT627291	hsa-miR-30a-3p	HITS-CLIP	23824327
MIRT627290	hsa-miR-30d-3p	HITS-CLIP	23824327
MIRT627289	hsa-miR-30e-3p	HITS-CLIP	23824327
MIRT651523	hsa-miR-548an	HITS-CLIP	23824327
MIRT651522	hsa-miR-124-3p	HITS-CLIP	23824327
MIRT651521	hsa-miR-129-1-3p	HITS-CLIP	23824327
MIRT651520	hsa-miR-129-2-3p	HITS-CLIP	23824327
MIRT651519	hsa-miR-3183	HITS-CLIP	23824327
MIRT651518	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT651517	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT651516	hsa-miR-3615	HITS-CLIP	23824327
MIRT651514	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT651515	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT651513	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT651512	hsa-miR-518a-5p	HITS-CLIP	23824327
MIRT651511	hsa-miR-527	HITS-CLIP	23824327
MIRT651510	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT627293	hsa-miR-4328	HITS-CLIP	23824327
MIRT627292	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT627291	hsa-miR-30a-3p	HITS-CLIP	23824327
MIRT627290	hsa-miR-30d-3p	HITS-CLIP	23824327
MIRT627289	hsa-miR-30e-3p	HITS-CLIP	23824327
MIRT627288	hsa-miR-4455	HITS-CLIP	23824327
MIRT627287	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT1493743	hsa-miR-1224-5p	CLIP-seq
MIRT1493744	hsa-miR-1238	CLIP-seq
MIRT1493745	hsa-miR-129-3p	CLIP-seq
MIRT1493746	hsa-miR-1470	CLIP-seq
MIRT1493747	hsa-miR-24	CLIP-seq
MIRT1493748	hsa-miR-28-5p	CLIP-seq
MIRT1493749	hsa-miR-3139	CLIP-seq
MIRT1493750	hsa-miR-3150a-3p	CLIP-seq
MIRT1493751	hsa-miR-3155	CLIP-seq
MIRT1493752	hsa-miR-3155b	CLIP-seq
MIRT1493753	hsa-miR-3170	CLIP-seq
MIRT1493754	hsa-miR-3175	CLIP-seq
MIRT1493755	hsa-miR-3189-5p	CLIP-seq
MIRT1493756	hsa-miR-3192	CLIP-seq
MIRT1493757	hsa-miR-3194-5p	CLIP-seq
MIRT1493758	hsa-miR-3198	CLIP-seq
MIRT1493759	hsa-miR-326	CLIP-seq
MIRT1493760	hsa-miR-330-5p	CLIP-seq
MIRT1493761	hsa-miR-342-5p	CLIP-seq
MIRT1493762	hsa-miR-3612	CLIP-seq
MIRT1493763	hsa-miR-3652	CLIP-seq
MIRT1493764	hsa-miR-3657	CLIP-seq
MIRT1493765	hsa-miR-3689a-3p	CLIP-seq
MIRT1493766	hsa-miR-3689c	CLIP-seq
MIRT1493767	hsa-miR-3914	CLIP-seq
MIRT1493768	hsa-miR-3918	CLIP-seq
MIRT1493769	hsa-miR-4266	CLIP-seq
MIRT1493770	hsa-miR-4309	CLIP-seq
MIRT1493771	hsa-miR-4314	CLIP-seq
MIRT1493772	hsa-miR-432	CLIP-seq
MIRT1493773	hsa-miR-4430	CLIP-seq
MIRT1493774	hsa-miR-4453	CLIP-seq
MIRT1493775	hsa-miR-4488	CLIP-seq
MIRT1493776	hsa-miR-4505	CLIP-seq
MIRT1493777	hsa-miR-4512	CLIP-seq
MIRT1493778	hsa-miR-4538	CLIP-seq
MIRT1493779	hsa-miR-4646-5p	CLIP-seq
MIRT1493780	hsa-miR-4664-5p	CLIP-seq
MIRT1493781	hsa-miR-4667-3p	CLIP-seq
MIRT1493782	hsa-miR-4667-5p	CLIP-seq
MIRT1493783	hsa-miR-4669	CLIP-seq
MIRT1493784	hsa-miR-4695-5p	CLIP-seq
MIRT1493785	hsa-miR-4697-5p	CLIP-seq
MIRT1493786	hsa-miR-4700-5p	CLIP-seq
MIRT1493787	hsa-miR-4704-5p	CLIP-seq
MIRT1493788	hsa-miR-4728-5p	CLIP-seq
MIRT1493789	hsa-miR-4731-5p	CLIP-seq
MIRT1493790	hsa-miR-4751	CLIP-seq
MIRT1493791	hsa-miR-4758-3p	CLIP-seq
MIRT1493792	hsa-miR-4764-5p	CLIP-seq
MIRT1493793	hsa-miR-4773	CLIP-seq
MIRT1493794	hsa-miR-4779	CLIP-seq
MIRT1493795	hsa-miR-484	CLIP-seq
MIRT1493796	hsa-miR-486-5p	CLIP-seq
MIRT1493797	hsa-miR-503	CLIP-seq
MIRT1493798	hsa-miR-541	CLIP-seq
MIRT1493799	hsa-miR-548ac	CLIP-seq
MIRT1493800	hsa-miR-548d-3p	CLIP-seq
MIRT1493801	hsa-miR-548z	CLIP-seq
MIRT1493802	hsa-miR-615-5p	CLIP-seq
MIRT1493803	hsa-miR-635	CLIP-seq
MIRT1493804	hsa-miR-637	CLIP-seq
MIRT1493805	hsa-miR-642a	CLIP-seq
MIRT1493806	hsa-miR-647	CLIP-seq
MIRT1493807	hsa-miR-650	CLIP-seq
MIRT1493808	hsa-miR-651	CLIP-seq
MIRT1493809	hsa-miR-654-5p	CLIP-seq
MIRT1493810	hsa-miR-665	CLIP-seq
MIRT1493811	hsa-miR-708	CLIP-seq
MIRT1493812	hsa-miR-711	CLIP-seq
MIRT1493813	hsa-miR-767-5p	CLIP-seq
MIRT1493814	hsa-miR-939	CLIP-seq
MIRT1493768	hsa-miR-3918	CLIP-seq
MIRT1493777	hsa-miR-4512	CLIP-seq
MIRT1493793	hsa-miR-4773	CLIP-seq
MIRT1493796	hsa-miR-486-5p	CLIP-seq
MIRT2369194	hsa-miR-1273g	CLIP-seq
MIRT2369195	hsa-miR-1285	CLIP-seq
MIRT2369196	hsa-miR-1913	CLIP-seq
MIRT2369197	hsa-miR-3187-5p	CLIP-seq
MIRT2369198	hsa-miR-324-3p	CLIP-seq
MIRT2369199	hsa-miR-4487	CLIP-seq
MIRT2369200	hsa-miR-612	CLIP-seq
MIRT2369201	hsa-miR-670	CLIP-seq
MIRT2369202	hsa-miR-876-3p	CLIP-seq
MIRT2397026	hsa-miR-661	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
EGR1	Repression	18281035
EGR1	Unknown	21436631
RUNX3	Repression	22171134
TCF4	Unknown	21436631

107

Show/Hide all (107)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001656	Process	Metanephros development	IEA
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	IEA
GO:0001822	Process	Kidney development	IEP	15312687
GO:0001823	Process	Mesonephros development	IEA
GO:0001837	Process	Epithelial to mesenchymal transition	IEP	12841867
GO:0001838	Process	Embryonic epithelial tube formation	IEA
GO:0001889	Process	Liver development	IEP	15312687
GO:0003714	Function	Transcription corepressor activity	IEA
GO:0003714	Function	Transcription corepressor activity	ISS
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005109	Function	Frizzled binding	IBA
GO:0005109	Function	Frizzled binding	IEA
GO:0005125	Function	Cytokine activity	IBA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	16959810
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IDA	16959810
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005796	Component	Golgi lumen	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0007276	Process	Gamete generation	IEA
GO:0007548	Process	Sex differentiation	IEA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	IEA
GO:0008584	Process	Male gonad development	IEA
GO:0008584	Process	Male gonad development	IEP	17848411
GO:0008584	Process	Male gonad development	IMP	11283799
GO:0008585	Process	Female gonad development	IEA
GO:0009267	Process	Cellular response to starvation	IEA
GO:0009986	Component	Cell surface	IEA
GO:0009986	Component	Cell surface	ISS
GO:0010629	Process	Negative regulation of gene expression	IDA	15317892
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010894	Process	Negative regulation of steroid biosynthetic process	IDA	15317892, 18182450
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0022407	Process	Regulation of cell-cell adhesion	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030182	Process	Neuron differentiation	IBA
GO:0030237	Process	Female sex determination	IMP	11283799
GO:0030325	Process	Adrenal gland development	IEP	12844346
GO:0030336	Process	Negative regulation of cell migration	IEA
GO:0030501	Process	Positive regulation of bone mineralization	IDA	17720811
GO:0030666	Component	Endocytic vesicle membrane	TAS
GO:0031012	Component	Extracellular matrix	IEA
GO:0032349	Process	Positive regulation of aldosterone biosynthetic process	IDA	16981135
GO:0032967	Process	Positive regulation of collagen biosynthetic process	IDA	17720811
GO:0033077	Process	T cell differentiation in thymus	IEA
GO:0033080	Process	Immature T cell proliferation in thymus	IEA
GO:0035239	Process	Tube morphogenesis	IEA
GO:0035567	Process	Non-canonical Wnt signaling pathway	IDA	17720811
GO:0035567	Process	Non-canonical Wnt signaling pathway	IEA
GO:0040037	Process	Negative regulation of fibroblast growth factor receptor signaling pathway	IEA
GO:0042445	Process	Hormone metabolic process	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	17720811
GO:0045165	Process	Cell fate commitment	IBA
GO:0045165	Process	Cell fate commitment	IEA
GO:0045596	Process	Negative regulation of cell differentiation	IEA
GO:0045669	Process	Positive regulation of osteoblast differentiation	IDA	17720811
GO:0045836	Process	Positive regulation of meiotic nuclear division	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	12949260
GO:0045892	Process	Negative regulation of DNA-templated transcription	ISS
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	16959810, 16981135, 18182450
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS	11283799
GO:0046580	Process	Negative regulation of Ras protein signal transduction	IEA
GO:0048018	Function	Receptor ligand activity	IDA	16959810
GO:0048599	Process	Oocyte development	IEA
GO:0048754	Process	Branching morphogenesis of an epithelial tube	IEA
GO:0051145	Process	Smooth muscle cell differentiation	IEA
GO:0051496	Process	Positive regulation of stress fiber assembly	IEA
GO:0051894	Process	Positive regulation of focal adhesion assembly	IEA
GO:0060008	Process	Sertoli cell differentiation	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0060070	Process	Canonical Wnt signaling pathway	IDA	15317892, 16959810, 18182450
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060126	Process	Somatotropin secreting cell differentiation	IEA
GO:0060129	Process	Thyroid-stimulating hormone-secreting cell differentiation	IEA
GO:0060231	Process	Mesenchymal to epithelial transition	IEA
GO:0060748	Process	Tertiary branching involved in mammary gland duct morphogenesis	IEA
GO:0060993	Process	Kidney morphogenesis	IEA
GO:0061045	Process	Negative regulation of wound healing	IEA
GO:0061180	Process	Mammary gland epithelium development	IEP	8168088
GO:0061184	Process	Positive regulation of dermatome development	IDA	10654605
GO:0061205	Process	Paramesonephric duct development	IEA
GO:0061205	Process	Paramesonephric duct development	IMP	18182450
GO:0061369	Process	Negative regulation of testicular blood vessel morphogenesis	IMP	12949260
GO:0070062	Component	Extracellular exosome	TAS
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEP	15040835
GO:0072006	Process	Nephron development	IEA
GO:0072033	Process	Renal vesicle formation	IEA
GO:0072034	Process	Renal vesicle induction	IEA
GO:0072162	Process	Metanephric mesenchymal cell differentiation	NAS	16368682
GO:0072164	Process	Mesonephric tubule development	IEA
GO:0072174	Process	Metanephric tubule formation	IEA
GO:0072210	Process	Metanephric nephron development	IEA
GO:0072273	Process	Metanephric nephron morphogenesis	IEA
GO:0097190	Process	Apoptotic signaling pathway	IEA
GO:0140013	Process	Meiotic nuclear division	IEA
GO:1904238	Process	Pericyte cell differentiation	IEA
GO:2000019	Process	Negative regulation of male gonad development	IMP	11283799
GO:2000066	Process	Positive regulation of cortisol biosynthetic process	IDA	16981135
GO:2000180	Process	Negative regulation of androgen biosynthetic process	IDA	16959810
GO:2000225	Process	Negative regulation of testosterone biosynthetic process	IEA
GO:2000225	Process	Negative regulation of testosterone biosynthetic process	IMP	12949260
GO:2001234	Process	Negative regulation of apoptotic signaling pathway	IEA

MIM	HGNC	e!Ensembl
603490	12783	ENSG00000162552

P56705

Protein name

Protein Wnt-4

Protein function

Ligand for members of the frizzled family of seven transmembrane receptors (Probable). Plays an important role in the embryonic development of the urogenital tract and the lung (PubMed:15317892, PubMed:16959810, PubMed:18179883, PubMed:18182450)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00110	wnt	45 → 351	wnt family	Family

Sequence

MSPRSCLRSLRLLVFAVFSAAASNWLYLAKLSSVGSISEEETCEKLKGLIQRQVQMCKRN
LEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGV
AFAVTRACSSGELEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKGAS
SSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDG
ATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDMRSGVLGTRGRTCNKTS
KAIDGCELLCCGRGFHTAQVELAERCSCKFHWCCFVKCRQCQRLVELHTCR

Sequence length

351

Interactions

View interactions

	KEGG		Reactome
	mTOR signaling pathway Wnt signaling pathway Axon guidance Hippo signaling pathway Signaling pathways regulating pluripotency of stem cells Melanogenesis Thyroid hormone signaling pathway Cushing syndrome Alzheimer disease Pathways of neurodegeneration - multiple diseases Human papillomavirus infection Pathways in cancer Proteoglycans in cancer Basal cell carcinoma Breast cancer Hepatocellular carcinoma Gastric cancer		WNT ligand biogenesis and trafficking PCP/CE pathway

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Mullerian aplasia and hyperandrogenism	Pathogenic	rs121908650, rs121908652, rs121908653	RCV000006688 RCV000006690 RCV000006691
SERKAL syndrome	Pathogenic	rs121908651	RCV000006689

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Mayer-Rokitansky-Kuster-Hauser syndrome	Uncertain significance	rs1334778982	RCV000714700
WNT4-related disorder	Likely benign; Uncertain significance; Benign	rs201963772, rs924091975, rs557427439, rs372735339, rs143835757, rs779327911, rs2522465430, rs774167732	RCV003906286 RCV003399648 RCV003404197 RCV003909017 RCV003956467 RCV003982711 RCV003896380 RCV003954700

Show/Hide Text Mining Associations (62)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Abortion Spontaneous	Associate	35300692
Acquired ichthyosis	Associate	36303457
Amyotrophic Lateral Sclerosis	Stimulate	30924074
Asthma	Associate	29505605
Breast Neoplasms	Associate	31740580, 38112643
Carcinoma Basal Cell	Inhibit	11348463
Carcinoma Hepatocellular	Associate	18577996
Carcinoma Lobular	Associate	27650553, 38112643
Carcinoma Renal Cell	Associate	33804101
Carcinoma Squamous Cell	Associate	12841867, 25901368
Colorectal Neoplasms	Associate	36303457
Diabetes Mellitus Type 1	Associate	36303457
Diabetic Nephropathies	Stimulate	31957842
Disorder of Sex Development 46 XY	Associate	39285472
Disorders of Sex Development	Associate	16959810, 26573569, 31746433
Diverticulosis Colonic	Associate	31089239
Diverticulum	Associate	31089239
Dry Eye Syndromes	Associate	19011014
Dupuytren Contracture	Associate	21732829
Endocrine System Diseases	Associate	27650553
Endometrial Neoplasms	Associate	9099960
Endometriosis	Associate	22259059, 23472165, 25154675, 25296917, 26139156, 28901453, 30010178
Endometriosis	Stimulate	24661731
Fetal Death	Stimulate	35300692
Gallbladder Diseases	Associate	26111189
Genital Neoplasms Female	Associate	38112643
Glomerulonephritis IGA	Associate	31067548
Glomerulonephritis Membranous	Stimulate	31067548
Glomerulosclerosis Focal Segmental	Associate	31067548, 35886848
Heart Diseases	Associate	34519627, 35673578
Hereditary renal agenesis	Associate	34311961
Heterotaxy Syndrome	Associate	26111189
Hyperandrogenism	Associate	21377155, 24641817, 37124138
Infections	Inhibit	32121148
Infertility	Associate	26139156, 36303457
Kidney Diseases	Associate	31067548
Kidney Failure Chronic	Associate	28901453
Leiomyoma	Associate	26820714, 32892998, 35689443
Leukemia	Associate	24274766
Lupus Nephritis	Associate	31067548
Melanoma	Associate	36303457
MINOCA	Associate	38139440
Mucopolysaccharidosis III	Stimulate	26458489
Mullerian aplasia	Associate	15317892, 16959810, 21377155, 24641817, 34099025, 35361250
Myocardial Reperfusion Injury	Associate	35673578
Myocardial Stunning	Associate	35673578
Myostatin related muscle hypertrophy	Associate	29505605
Nasal Polyps	Associate	28059551
Neoplasms	Associate	18577996, 24274766, 33828085, 34841720, 36303457, 38112643
Neoplasms	Stimulate	26820714, 33986121
Nephrosis congenital	Associate	35886848
Obesity	Associate	28272483
Ovarian Neoplasms	Associate	38112643
Primary Ovarian Insufficiency	Associate	21624127
Renal Insufficiency Chronic	Associate	31067548
Reperfusion Injury	Associate	31284268
Status Asthmaticus	Associate	29505605
Stomach Neoplasms	Associate	25995617
Triple Negative Breast Neoplasms	Associate	26458489, 32471192
Urinary Bladder Neoplasms	Associate	30475758
Virilism	Associate	15317892, 16959810
Werner Syndrome	Associate	34311961

WNT4 (Wnt family member 4)