Gene Gene information from NCBI Gene database.
Entrez ID 54206
Gene name ERBB receptor feedback inhibitor 1
Gene symbol ERRFI1
Synonyms (NCBI Gene)
GENE-33MIG-6MIG6RALT
Chromosome 1
Chromosome location 1p36.23
Summary ERRFI1 is a cytoplasmic protein whose expression is upregulated with cell growth (Wick et al., 1995 [PubMed 7641805]). It shares significant homology with the protein product of rat gene-33, which is induced during cell stress and mediates cell signaling
miRNA miRNA information provided by mirtarbase database.
327
miRTarBase ID miRNA Experiments Reference
MIRT006520 hsa-miR-200c-3p Luciferase reporter assay 19671845
MIRT006520 hsa-miR-200c-3p Luciferase reporter assay 19671845
MIRT006520 hsa-miR-200c-3p Luciferase reporter assay 19671845
MIRT006520 hsa-miR-200c-3p Luciferase reporter assay 19671845
MIRT006520 hsa-miR-200c-3p Luciferase reporter assay 19671845
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
72
GO ID Ontology Definition Evidence Reference
GO:0001501 Process Skeletal system development IEA
GO:0001889 Process Liver development IEA
GO:0001894 Process Tissue homeostasis IEA
GO:0005096 Function GTPase activator activity TAS 10749885
GO:0005515 Function Protein binding IPI 15778465, 18046415, 18776048, 20936779, 21706016, 21988832, 22505024, 23273428, 24189400, 25640309, 28514442, 31980649, 32296183, 33961781, 34591642, 35384245, 35512704
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
608069 18185 ENSG00000116285
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UJM3
Protein name ERBB receptor feedback inhibitor 1 (Mitogen-inducible gene 6 protein) (MIG-6)
Protein function Negative regulator of EGFR signaling in skin morphogenesis. Acts as a negative regulator for several EGFR family members, including ERBB2, ERBB3 and ERBB4. Inhibits EGFR catalytic activity by interfering with its dimerization. Inhibits autophosp
PDB 2RF9 , 2RFD , 2RFE , 4I21 , 4R3P , 4R3R , 4ZJV
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09027 GTPase_binding 6 68 GTPase binding Domain
PF11555 Inhibitor_Mig-6 315 371 EGFR receptor inhibitor Mig-6 Family
Sequence
MSIAGVAAQEIRVPLKTGFLHNGRAMGNMRKTYWSSRSEFKNNFLNIDPITMAYSLNSSA
QERLIPLG
HASKSAPMNGHCFAENGPSQKSSLPPLLIPPSENLGPHEEDQVVCGFKKLTV
NGVCASTPPLTPIKNSPSLFPCAPLCERGSRPLPPLPISEALSLDDTDCEVEFLTSSDTD
FLLEDSTLSDFKYDVPGRRSFRGCGQINYAYFDTPAVSAADLSYVSDQNGGVPDPNPPPP
QTHRRLRRSHSGPAGSFNKPAIRISNCCIHRASPNSDEDKPEVPPRVPIPPRPVKPDYRR
WSAEVTSSTYSDEDRPPKVPPREPLSPSNSRTPSPKSLPSYLNGVMPPTQSFAPDPKYVS
SKALQRQNSEG
SASKVPCILPIIENGKKVSSTHYYLLPERPPYLDKYEKFFREAEETNGG
AQIQPLPADCGISSATEKPDSKTKMDLGGHVKRKHLSYVVSP
Sequence length 462
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Cervical cancer Benign rs35110052 RCV005910384
Nonpapillary renal cell carcinoma Benign rs35110052 RCV005910383
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 30021798
Atherosclerosis Associate 37699925
Breast Neoplasms Inhibit 27341132, 33046784
Breast Neoplasms Associate 32377505, 32432675, 35441810, 35859293
Carcinogenesis Associate 12387890
Carcinogenesis Inhibit 26760771, 27557663
Carcinoma Hepatocellular Associate 17006932, 28734040, 35165519
Carcinoma Non Small Cell Lung Associate 25400829, 37834326
Chemical and Drug Induced Liver Injury Associate 35850069
Diabetes Mellitus Associate 23324575, 35301888