Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
54206
Gene name Gene Name - the full gene name approved by the HGNC.
ERBB receptor feedback inhibitor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ERRFI1
Synonyms (NCBI Gene) Gene synonyms aliases
GENE-33, MIG-6, MIG6, RALT
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p36.23
Summary Summary of gene provided in NCBI Entrez Gene.
ERRFI1 is a cytoplasmic protein whose expression is upregulated with cell growth (Wick et al., 1995 [PubMed 7641805]). It shares significant homology with the protein product of rat gene-33, which is induced during cell stress and mediates cell signaling
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT006520 hsa-miR-200c-3p Luciferase reporter assay 19671845
MIRT006520 hsa-miR-200c-3p Luciferase reporter assay 19671845
MIRT006520 hsa-miR-200c-3p Luciferase reporter assay 19671845
MIRT006520 hsa-miR-200c-3p Luciferase reporter assay 19671845
MIRT006520 hsa-miR-200c-3p Luciferase reporter assay 19671845
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001501 Process Skeletal system development IEA
GO:0001889 Process Liver development IEA
GO:0001894 Process Tissue homeostasis IEA
GO:0005096 Function GTPase activator activity TAS 10749885
GO:0005515 Function Protein binding IPI 15778465, 18046415, 18776048, 20936779, 21706016, 21988832, 22505024, 23273428, 24189400, 25640309, 28514442, 31980649, 32296183, 33961781, 34591642, 35384245, 35512704
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608069 18185 ENSG00000116285
Protein
UniProt ID Q9UJM3
Protein name ERBB receptor feedback inhibitor 1 (Mitogen-inducible gene 6 protein) (MIG-6)
Protein function Negative regulator of EGFR signaling in skin morphogenesis. Acts as a negative regulator for several EGFR family members, including ERBB2, ERBB3 and ERBB4. Inhibits EGFR catalytic activity by interfering with its dimerization. Inhibits autophosp
PDB 2RF9 , 2RFD , 2RFE , 4I21 , 4R3P , 4R3R , 4ZJV
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09027 GTPase_binding 6 68 GTPase binding Domain
PF11555 Inhibitor_Mig-6 315 371 EGFR receptor inhibitor Mig-6 Family
Sequence
MSIAGVAAQEIRVPLKTGFLHNGRAMGNMRKTYWSSRSEFKNNFLNIDPITMAYSLNSSA
QERLIPLG
HASKSAPMNGHCFAENGPSQKSSLPPLLIPPSENLGPHEEDQVVCGFKKLTV
NGVCASTPPLTPIKNSPSLFPCAPLCERGSRPLPPLPISEALSLDDTDCEVEFLTSSDTD
FLLEDSTLSDFKYDVPGRRSFRGCGQINYAYFDTPAVSAADLSYVSDQNGGVPDPNPPPP
QTHRRLRRSHSGPAGSFNKPAIRISNCCIHRASPNSDEDKPEVPPRVPIPPRPVKPDYRR
WSAEVTSSTYSDEDRPPKVPPREPLSPSNSRTPSPKSLPSYLNGVMPPTQSFAPDPKYVS
SKALQRQNSEG
SASKVPCILPIIENGKKVSSTHYYLLPERPPYLDKYEKFFREAEETNGG
AQIQPLPADCGISSATEKPDSKTKMDLGGHVKRKHLSYVVSP
Sequence length 462
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Acne acne vulgaris N/A N/A GWAS
Breast Cancer Breast cancer N/A N/A GWAS
Celiac disease Celiac disease N/A N/A GWAS
Crohn Disease Crohn's disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 30021798
Atherosclerosis Associate 37699925
Breast Neoplasms Inhibit 27341132, 33046784
Breast Neoplasms Associate 32377505, 32432675, 35441810, 35859293
Carcinogenesis Associate 12387890
Carcinogenesis Inhibit 26760771, 27557663
Carcinoma Hepatocellular Associate 17006932, 28734040, 35165519
Carcinoma Non Small Cell Lung Associate 25400829, 37834326
Chemical and Drug Induced Liver Injury Associate 35850069
Diabetes Mellitus Associate 23324575, 35301888