SEPTIN5 (septin 5)

Gene

• Entrez ID: 5413
• Gene name: Septin 5
• Gene symbol: SEPTIN5
• Synonyms (NCBI Gene): CDCREL, CDCREL-1, CDCREL1, H5, HCDCREL-1, PNUTL1, SEPT5, Septin-5
• Chromosome: 22
• Chromosome location: 22q11.21
• Summary: This gene is a member of the septin gene family of nucleotide binding proteins, originally described in yeast as cell division cycle regulatory proteins. Septins are highly conserved in yeast, Drosophila, and mouse and appear to regulate cytoskeletal orga

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	TAS	9385360, 21563316
GO:0005198	Function	Structural molecule activity	TAS	9611266
GO:0005515	Function	Protein binding	IPI	10321247, 15214843, 16767699, 18330356, 24722188, 25416956, 28514442, 31515488, 32296183, 32814053, 33961781, 35271311
GO:0005525	Function	GTP binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA	10321247
GO:0005940	Component	Septin ring	IBA
GO:0008021	Component	Synaptic vesicle	IBA
GO:0008021	Component	Synaptic vesicle	IDA	10321247
GO:0008104	Process	Intracellular protein localization	IBA
GO:0015630	Component	Microtubule cytoskeleton	IBA
GO:0016080	Process	Synaptic vesicle targeting	TAS	10321247
GO:0017157	Process	Regulation of exocytosis	IBA
GO:0017157	Process	Regulation of exocytosis	IMP	10321247
GO:0030534	Process	Adult behavior	ISS
GO:0031105	Component	Septin complex	IBA
GO:0031105	Component	Septin complex	ISS
GO:0032153	Component	Cell division site	IBA
GO:0035176	Process	Social behavior	ISS
GO:0042802	Function	Identical protein binding	IPI	15214843, 24722188, 25416956
GO:0051301	Process	Cell division	IEA
GO:0060090	Function	Molecular adaptor activity	IBA
GO:0061640	Process	Cytoskeleton-dependent cytokinesis	IBA
GO:2000300	Process	Regulation of synaptic vesicle exocytosis	TAS	21563316

Other IDs

• MIM: 602724
• HGNC: 9164
• e!Ensembl: ENSG00000184702

Protein

• UniProt ID: Q99719
• Protein name: Septin-5 (Cell division control-related protein 1) (CDCrel-1) (Peanut-like protein 1)
• Protein function: Filament-forming cytoskeletal GTPase (By similarity). May play a role in cytokinesis (Potential). May play a role in platelet secretion (By similarity).
• PDB: 6WCU
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00735	Septin	41 → 321	Septin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed at high levels in the CNS, as well as in heart and platelets (at protein level). {ECO:0000269|PubMed:12023038, ECO:0000269|PubMed:15915442}.
• Sequence:

  MSTGLRYKSKLATPEDKQDIDKQYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTL
  VHSLFLTDLYKDRKLLSAEERISQTVEILKHTVDIEEKGVKLKLTIVDTPGFGDAVNNTE
  CWKPITDYVDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPVDVGFMKALHE
  KVNIVPLIAKADCLVPSEIRKLKERIREEIDKFGIHVYQFPECDSDEDEDFKQQDRELKE
  SAPFAVIGSNTVVEAKGQRVRGRLYPWGIVEVENQAHCDFVKLRNMLIRTHMHDLKDVTC
  DVHYENYRAHCIQQMTSKLTQDSRMESPIPILPLPTPDAETEKLIRMKDEELRRMQEMLQ
  RMKQQMQDQ

• Sequence length: 369

Pathways

KEGG:

Parkinson disease
Pathways of neurodegeneration - multiple diseases