Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	54112
Gene name Gene Name - the full gene name approved by the HGNC.	G protein-coupled receptor 88
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GPR88
Synonyms (NCBI Gene) Gene synonyms aliases	COCPMR, STRG
Disease Acronyms (UniProt) Disease acronyms from UniProt database	COCPMR
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p21.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a G protein-coupled receptor found almost exclusively in the striatum, a brain structure that controls motor function and cognition. Defects in this gene have been associated with chorea, speech delay, and learning diff

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs875989788	C>A	Pathogenic	Coding sequence variant, stop gained

Show/Hide all(21)

miRTarBase ID	miRNA	Experiments
MIRT1031972	hsa-miR-1207-3p	CLIP-seq
MIRT1031973	hsa-miR-1276	CLIP-seq
MIRT1031974	hsa-miR-140-3p	CLIP-seq
MIRT1031975	hsa-miR-3119	CLIP-seq
MIRT1031976	hsa-miR-3121-3p	CLIP-seq
MIRT1031977	hsa-miR-3168	CLIP-seq
MIRT1031978	hsa-miR-34b	CLIP-seq
MIRT1031979	hsa-miR-4663	CLIP-seq
MIRT1031980	hsa-miR-577	CLIP-seq
MIRT1031981	hsa-miR-628-5p	CLIP-seq
MIRT1549371	hsa-miR-1248	CLIP-seq
MIRT1549372	hsa-miR-3121-5p	CLIP-seq
MIRT1549373	hsa-miR-4778-3p	CLIP-seq
MIRT1549374	hsa-miR-9	CLIP-seq
MIRT2006088	hsa-miR-1305	CLIP-seq
MIRT2006089	hsa-miR-149	CLIP-seq
MIRT2006090	hsa-miR-4256	CLIP-seq
MIRT2006091	hsa-miR-591	CLIP-seq
MIRT2006092	hsa-miR-593	CLIP-seq
MIRT2006093	hsa-miR-607	CLIP-seq
MIRT2006094	hsa-miR-760	CLIP-seq

Show/Hide all(16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003774	Function	Motor activity	ISS
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	ISS
GO:0005886	Component	Plasma membrane	ISS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005929	Component	Cilium	IDA	28154160
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	NAS	11056049
GO:0007602	Process	Phototransduction	IBA	21873635
GO:0007626	Process	Locomotory behavior	IEA
GO:0008020	Function	G protein-coupled photoreceptor activity	IBA	21873635
GO:0009584	Process	Detection of visible light	IEA
GO:0019228	Process	Neuronal action potential	IEA
GO:0050885	Process	Neuromuscular process controlling balance	IEA
GO:0061743	Process	Motor learning	ISS
GO:0071482	Process	Cellular response to light stimulus	IBA	21873635

MIM	HGNC	e!Ensembl
607468	4539	ENSG00000181656

Protein

UniProt ID

Q9GZN0

Protein name

G protein-coupled receptor 88 (Striatum-specific G-protein coupled receptor)

Protein function

Orphan G protein-coupled receptor implicated in a large repertoire of behavioral responses that engage motor activities, spatial learning, and emotional processing (By similarity). May play a role in the regulation of cognitive and motor functio

PDB

7EJX , 7WZ4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	48 → 336	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed predominantly in the striatum. {ECO:0000269|PubMed:11056049}.

Sequence

MTNSSSTSTSSTTGGSLLLLCEEEESWAGRRIPVSLLYSGLAIGGTLANGMVIYLVSSFR
KLQTTSNAFIVNGCAADLSVCALWMPQEAVLGLLPTGSAEPPADWDGAGGSYRLLRGGLL
GLGLTVSLLSHCLVALNRYLLITRAPATYQALYQRRHTAGMLALSWALALGLVLLLPPWA
PRPGAAPPRVHYPALLAAAALLAQTALLLHCYLGIVRRVRVSVKRVSVLNFHLLHQLPGC
AAAAAAFPGAQHAPGPGGAAHPAQAQPLPPALHPRRAQRRLSGLSVLLLCCVFLLATQPL
VWVSLASGFSLPVPWGVQAASWLLCCALSALNPLLYTWRNEEFRRSVRSVLPGVGDAAAA
AVAATAVPAVSQAQLGTRAAGQHW

Sequence length

384

Interactions

View interactions

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID
Causal
Chorea with psychomotor retardation	CHOREA, CHILDHOOD-ONSET, WITH PSYCHOMOTOR RETARDATION	rs875989788
Developmental delay	Global developmental delay	rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291 View all (32 more)
Mental retardation	Intellectual Disability	rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315 View all (1024 more)

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text Mining
Intellectual Disability	Associate	39334510
Mental Disorders	Associate	24793972

GPR88 (G protein-coupled receptor 88)