TLR9 (toll like receptor 9)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
54106
Gene name Gene Name - the full gene name approved by the HGNC.
Toll like receptor 9
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TLR9
Synonyms (NCBI Gene) Gene synonyms aliases
CD289
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p21.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the Toll-like receptor (TLR) family, which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and fun
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(8)
miRTarBase ID miRNA Experiments Reference
MIRT736441 hsa-miR-491-3p qRT-PCR, Flow cytometry 33679688
MIRT2349590 hsa-miR-125a-3p CLIP-seq
MIRT2349591 hsa-miR-3194-3p CLIP-seq
MIRT2349592 hsa-miR-3934 CLIP-seq
MIRT2349593 hsa-miR-4710 CLIP-seq
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(9)
Transcription factor Regulation Reference
CEBPA Unknown 15294971
CREB1 Unknown 15294971
ELF1 Unknown 15294971
ELK1 Unknown 15294971
ETS2 Unknown 15294971
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(73)
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane TAS
GO:0002224 Process Toll-like receptor signaling pathway IBA 21873635
GO:0002224 Process Toll-like receptor signaling pathway TAS
GO:0002237 Process Response to molecule of bacterial origin TAS 15356140
GO:0002639 Process Positive regulation of immunoglobulin production IDA 23857366
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
605474 15633 ENSG00000239732
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q9NR96
Protein name Toll-like receptor 9 (CD antigen CD289)
Protein function Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. TLR9 is a nucleotide-sensing TLR which is activated by
PDB 8AR3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13855 LRR_8 50 → 98 Leucine rich repeat Repeat
PF13855 LRR_8 290 → 345 Leucine rich repeat Repeat
PF18837 LRR_12 393 → 422 Leucine-rich repeat Repeat
PF13855 LRR_8 701 → 762 Leucine rich repeat Repeat
PF01582 TIR 870 → 1030 TIR domain Family
Tissue specificity TISSUE SPECIFICITY: Highly expressed in spleen, lymph node, tonsil and peripheral blood leukocytes, especially in plasmacytoid pre-dendritic cells. Levels are much lower in monocytes and CD11c+ immature dendritic cells. Also detected in lung and liver.
Sequence 
MGFCRSALHPLSLLVQAIMLAMTLALGTLPAFLPCELQPHGLVNCNWLFLKSVPHFSMAA
PRGNVTSLSLSSNRIHHLHDSDFAHLPSLRHLNLKWNCPPVGLSPMHFPCHMTIEPSTFL
AVPTLEELNLSYNNIMTVPALPKSLISLSLSHTNILMLDSASLAGLHALRFLFMDGNCYY
KNPCRQALEVAPGALLGLGNLTHLSLKYNNLTVVPRNLPSSLEYLLLSYNRIVKLAPEDL
ANLTALRVLDVGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN
ASWFRGLGNLRVLDLSENFLYKCITKTKAFQGLTQLRKLNLSFNYQKRVSFAHLSLAPSF
GSLVALKELDMHGIFFRSLDETTLRPLARLPMLQTLRLQMNFINQAQLGIFRAFPGLRYV
DLSDNRISGASELTATMGEADGGEKVWLQPGDLAPAPVDTPSSEDFRPNCSTLNFTLDLS
RNNLVTVQPEMFAQLSHLQCLRLSHNCISQAVNGSQFLPLTGLQVLDLSHNKLDLYHEHS
FTELPRLEALDLSYNSQPFGMQGVGHNFSFVAHLRTLRHLSLAHNNIHSQVSQQLCSTSL
RALDFSGNALGHMWAEGDLYLHFFQGLSGLIWLDLSQNRLHTLLPQTLRNLPKSLQVLRL
RDNYLAFFKWWSLHFLPKLEVLDLAGNQLKALTNGSLPAGTRLRRLDVSCNSISFVAPGF
FSKAKELRELNLSANALKTVDHSWFGPLASALQILDVSANPLHCACGAAFMDFLLEVQAA
VPGLPSRVKCGSPGQLQGLSIFAQDLRLCLDEALSWDCFALSLLAVALGLGVPMLHHLCG
WDLWYCFHLCLAWLPWRGRQSGRDEDALPYDAFVVFDKTQSAVADWVYNELRGQLEECRG
RWALRLCLEERDWLPGKTLFENLWASVYGSRKTLFVLAHTDRVSGLLRASFLLAQQRLLE
DRKDVVVLVILSPDGRRSRYVRLRQRLCRQSVLLWPHQPSGQRSFWAQLGMALTRDNHHF
YNRNFCQGPTAE
Sequence length 1032
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Toll-like receptor signaling pathway
Salmonella infection
Chagas disease
African trypanosomiasis
Malaria
Tuberculosis
Measles
Herpes simplex virus 1 infection
PD-L1 expression and PD-1 checkpoint pathway in cancer 		  PI3K Cascade
Trafficking and processing of endosomal TLR
Toll Like Receptor 9 (TLR9) Cascade
TRAF6 mediated IRF7 activation in TLR7/8 or 9 signaling
TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation
MyD88 dependent cascade initiated on endosome
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Colorectal cancer Colorectal Carcinoma rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800
View all (467 more)
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Crohn disease Crohn Disease, Regional enteritis 17914947, 15236225 ClinVar
Show/Hide Text Mining Associations (300)
Associations from Text Mining
Disease Name Relationship Type References
3 Hydroxy 3 Methylglutaryl CoA Lyase Deficiency Associate 35905120
AA amyloidosis Inhibit 23957925
Achondroplasia and Swiss type agammaglobulinemia Associate 17932028
Acidosis Renal Tubular Associate 31002145
Acquired Immunodeficiency Syndrome Associate 33777838, 36926756
Acute Disease Stimulate 20416452
Acute Kidney Injury Associate 25293716
Adenocarcinoma of Lung Associate 37746997
Alcoholism Associate 34415075
Allergic Fungal Sinusitis Associate 25133733, 31238737