Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	53840
Gene name Gene Name - the full gene name approved by the HGNC.	Tripartite motif containing 34
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TRIM34
Synonyms (NCBI Gene) Gene synonyms aliases	IFP1, RNF21
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11p15.4
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, B-box type 1 and B-box type 2 domain, and a coiled-coil region. Expression of this gene is up-regulated by inte

Show/Hide all(52)

miRTarBase ID	miRNA	Experiments
MIRT1454268	hsa-miR-1293	CLIP-seq
MIRT1454269	hsa-miR-337-3p	CLIP-seq
MIRT1454270	hsa-miR-4483	CLIP-seq
MIRT1454271	hsa-miR-4651	CLIP-seq
MIRT1454272	hsa-miR-608	CLIP-seq
MIRT1454273	hsa-miR-876-3p	CLIP-seq
MIRT2357121	hsa-miR-433	CLIP-seq
MIRT2357122	hsa-miR-548l	CLIP-seq
MIRT2357123	hsa-miR-664	CLIP-seq
MIRT2650735	hsa-miR-1193	CLIP-seq
MIRT2650736	hsa-miR-1265	CLIP-seq
MIRT1454268	hsa-miR-1293	CLIP-seq
MIRT2650737	hsa-miR-196a	CLIP-seq
MIRT2650738	hsa-miR-196b	CLIP-seq
MIRT2650739	hsa-miR-2861	CLIP-seq
MIRT2650740	hsa-miR-3074-3p	CLIP-seq
MIRT2650741	hsa-miR-3144-3p	CLIP-seq
MIRT2650742	hsa-miR-323-5p	CLIP-seq
MIRT1454269	hsa-miR-337-3p	CLIP-seq
MIRT2650743	hsa-miR-3927	CLIP-seq
MIRT2650744	hsa-miR-4438	CLIP-seq
MIRT1454270	hsa-miR-4483	CLIP-seq
MIRT1454271	hsa-miR-4651	CLIP-seq
MIRT2650745	hsa-miR-4757-5p	CLIP-seq
MIRT2650746	hsa-miR-4781-3p	CLIP-seq
MIRT2650747	hsa-miR-490-5p	CLIP-seq
MIRT2650748	hsa-miR-548b-3p	CLIP-seq
MIRT1454272	hsa-miR-608	CLIP-seq
MIRT2650749	hsa-miR-660	CLIP-seq
MIRT1454273	hsa-miR-876-3p	CLIP-seq
MIRT2650735	hsa-miR-1193	CLIP-seq
MIRT2650736	hsa-miR-1265	CLIP-seq
MIRT1454268	hsa-miR-1293	CLIP-seq
MIRT2650737	hsa-miR-196a	CLIP-seq
MIRT2650738	hsa-miR-196b	CLIP-seq
MIRT2650739	hsa-miR-2861	CLIP-seq
MIRT2650740	hsa-miR-3074-3p	CLIP-seq
MIRT2650741	hsa-miR-3144-3p	CLIP-seq
MIRT2650742	hsa-miR-323-5p	CLIP-seq
MIRT1454269	hsa-miR-337-3p	CLIP-seq
MIRT2650743	hsa-miR-3927	CLIP-seq
MIRT2694168	hsa-miR-4276	CLIP-seq
MIRT2650744	hsa-miR-4438	CLIP-seq
MIRT1454270	hsa-miR-4483	CLIP-seq
MIRT1454271	hsa-miR-4651	CLIP-seq
MIRT2650745	hsa-miR-4757-5p	CLIP-seq
MIRT2650746	hsa-miR-4781-3p	CLIP-seq
MIRT2650747	hsa-miR-490-5p	CLIP-seq
MIRT2650748	hsa-miR-548b-3p	CLIP-seq
MIRT1454272	hsa-miR-608	CLIP-seq
MIRT2650749	hsa-miR-660	CLIP-seq
MIRT1454273	hsa-miR-876-3p	CLIP-seq

Show/Hide all(17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	17156811
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	TAS
GO:0008270	Function	Zinc ion binding	IEA
GO:0010468	Process	Regulation of gene expression	IBA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	17156811
GO:0045087	Process	Innate immune response	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0051607	Process	Defense response to virus	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0080090	Process	Regulation of primary metabolic process	IEA

MIM	HGNC	e!Ensembl
605684	10063	ENSG00000258659

Protein

UniProt ID

Q9BYJ4

Protein name

E3 ubiquitin-protein ligase TRIM34 (EC 2.3.2.27) (Interferon-responsive finger protein 1) (RING finger protein 21)

Protein function

Functions as antiviral protein and contributes to the defense against retroviral infections (PubMed:17156811, PubMed:32282853). Acts as a capsid-specific restriction factor with the help of TRIM5 and prevents infection from non-host-adapted retr

PDB

2EGP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15227	zf-C3HC4_4	15 → 59		Domain
PF00643	zf-B_box	92 → 133	B-box zinc finger	Domain
PF00622	SPRY	348 → 483	SPRY domain	Family

Tissue specificity

TISSUE SPECIFICITY: [Isoform 1]: Is the most abundant form. It is highly expressed in the placenta, spleen, colon and peripheral blood leukocytes. {ECO:0000269|PubMed:11013086}.

Sequence

MASKILLNVQEEVTCPICLELLTEPLSLDCGHSLCRACITVSNKEAVTSMGGKSSCPVCG
ISYSFEHLQANQHLANIVERLKEVKLSPDNGKKRDLCDHHGEKLLLFCKEDRKVICWLCE
RSQEHRGHHTVLTEEVFKECQEKLQAVLKRLKKEEEEAEKLEADIREEKTSWKYQVQTER
QRIQTEFDQLRSILNNEEQRELQRLEEEEKKTLDKFAEAEDELVQQKQLVRELISDVECR
SQWSTMELLQDMSGIMKWSEIWRLKKPKMVSKKLKTVFHAPDLSRMLQMFRELTAVRCYW
VDVTLNSVNLNLNLVLSEDQRQVISVPIWPFQCYNYGVLGSQYFSSGKHYWEVDVSKKTA
WILGVYCRTYSRHMKYVVRRCANRQNLYTKYRPLFGYWVIGLQNKCKYGVFEESLSSDPE
VLTLSMAVPPCRVGVFLDYEAGIVSFFNVTSHGSLIYKFSKCCFSQPVYPYFNPWNCPAP
MTLCPPSS

Sequence length

488

Interactions

View interactions

	Reactome
			Interferon gamma signaling

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Coronary artery disease	Coronary artery disease	N/A	N/A	GWAS

TRIM34 (tripartite motif containing 34)