GPR87 (G protein-coupled receptor 87)

Gene

• Entrez ID: 53836
• Gene name: G protein-coupled receptor 87
• Gene symbol: GPR87
• Synonyms (NCBI Gene): FKSG78, GPR95, KPG_002
• Chromosome: 3
• Chromosome location: 3q25.1
• Summary: This gene encodes a G protein-coupled receptor and is located in a cluster of G protein-couple receptor genes on chromosome 3. The encoded protein has been shown to be overexpressed in lung squamous cell carcinoma (PMID:18057535) and regulated by p53 (PMI

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018778	hsa-miR-335-5p	Microarray	18185580

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005886	Component	Plasma membrane	IC	17905198
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	17905198
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0016020	Component	Membrane	IEA
GO:0035329	Process	Hippo signaling	IDA	35429439
GO:0035589	Process	G protein-coupled purinergic nucleotide receptor signaling pathway	IEA
GO:0045028	Function	G protein-coupled purinergic nucleotide receptor activity	IBA
GO:0045028	Function	G protein-coupled purinergic nucleotide receptor activity	IDA	17905198
GO:0045028	Function	G protein-coupled purinergic nucleotide receptor activity	IEA
GO:0061621	Process	Canonical glycolysis	IDA	29298880

Other IDs

• MIM: 606379
• HGNC: 4538
• e!Ensembl: ENSG00000138271

Protein

• UniProt ID: Q9BY21
• Protein name: G-protein coupled receptor 87 (G-protein coupled receptor 95)
• Protein function: Receptor for lysophosphatidic acid (LPA) (PubMed:17905198). Necessary for p53/TP53-dependent survival in response to DNA damage (PubMed:19602589). Promotes the Hippo-YAP signaling pathway and thereby modulates glycolysis and oxidative stress pro
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	59 → 314	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in placenta and prostate. Weaker expression in thymus. Not expressed in thalamus, hippocampus, pons or cerebellum. Overexpressed in squamous cell carcinoma of the lung. {ECO:0000269|PubMed:17905198}.
• Sequence:

  MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPVLYLIIFVASILLN
  GLAVWIFFHIRNKTSFIFYLKNIVVADLIMTLTFPFRIVHDAGFGPWYFKFILCRYTSVL
  FYANMYTSIVFLGLISIDRYLKVVKPFGDSRMYSITFTKVLSVCVWVIMAVLSLPNIILT
  NGQPTEDNIHDCSKLKSPLGVKWHTAVTYVNSCLFVAVLVILIGCYIAISRYIHKSSRQF
  ISQSSRKRKHNQSIRVVVAVFFTCFLPYHLCRIPFTFSHLDRLLDESAQKILYYCKEITL
  FLSACNVCLDPIIYFFMCRSFSRRLFKKSNIRTRSESIRSLQSVRRSEVRIYYDYTDV

• Sequence length: 358