Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	53836
Gene name Gene Name - the full gene name approved by the HGNC.	G protein-coupled receptor 87
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GPR87
Synonyms (NCBI Gene) Gene synonyms aliases	FKSG78, GPR95, KPG_002
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3q25.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a G protein-coupled receptor and is located in a cluster of G protein-couple receptor genes on chromosome 3. The encoded protein has been shown to be overexpressed in lung squamous cell carcinoma (PMID:18057535) and regulated by p53 (PMI

Show/Hide all(1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018778	hsa-miR-335-5p	Microarray	18185580

Show/Hide all(14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005886	Component	Plasma membrane	IC	17905198
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	17905198
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0016020	Component	Membrane	IEA
GO:0035329	Process	Hippo signaling	IDA	35429439
GO:0035589	Process	G protein-coupled purinergic nucleotide receptor signaling pathway	IEA
GO:0045028	Function	G protein-coupled purinergic nucleotide receptor activity	IBA
GO:0045028	Function	G protein-coupled purinergic nucleotide receptor activity	IDA	17905198
GO:0045028	Function	G protein-coupled purinergic nucleotide receptor activity	IEA
GO:0061621	Process	Canonical glycolysis	IDA	29298880

MIM	HGNC	e!Ensembl
606379	4538	ENSG00000138271

Protein

UniProt ID

Q9BY21

Protein name

G-protein coupled receptor 87 (G-protein coupled receptor 95)

Protein function

Receptor for lysophosphatidic acid (LPA) (PubMed:17905198). Necessary for p53/TP53-dependent survival in response to DNA damage (PubMed:19602589). Promotes the Hippo-YAP signaling pathway and thereby modulates glycolysis and oxidative stress pro

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	59 → 314	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in placenta and prostate. Weaker expression in thymus. Not expressed in thalamus, hippocampus, pons or cerebellum. Overexpressed in squamous cell carcinoma of the lung. {ECO:0000269|PubMed:17905198}.

Sequence

MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPVLYLIIFVASILLN
GLAVWIFFHIRNKTSFIFYLKNIVVADLIMTLTFPFRIVHDAGFGPWYFKFILCRYTSVL
FYANMYTSIVFLGLISIDRYLKVVKPFGDSRMYSITFTKVLSVCVWVIMAVLSLPNIILT
NGQPTEDNIHDCSKLKSPLGVKWHTAVTYVNSCLFVAVLVILIGCYIAISRYIHKSSRQF
ISQSSRKRKHNQSIRVVVAVFFTCFLPYHLCRIPFTFSHLDRLLDESAQKILYYCKEITL
FLSACNVCLDPIIYFFMCRSFSRRLFKKSNIRTRSESIRSLQSVRRSEVRIYYDYTDV

Sequence length

358

Interactions

View interactions

GPR87 (G protein-coupled receptor 87)