Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5368
Gene name Gene Name - the full gene name approved by the HGNC.
Prepronociceptin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PNOC
Synonyms (NCBI Gene) Gene synonyms aliases
N/OFQ, NOP, OFQ, PPNOC, ppN/OFQ
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8p21.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products. These products include nociceptin, nocistatin, and orphanin FQ2 (OFQ2). Nociceptin, also known as orphanin FQ, is a 17-amino acid neuropeptide that
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT029788 hsa-miR-26b-5p Microarray 19088304
MIRT1245313 hsa-miR-31 CLIP-seq
MIRT1245314 hsa-miR-3154 CLIP-seq
MIRT1245315 hsa-miR-3179 CLIP-seq
MIRT1245316 hsa-miR-3656 CLIP-seq
Transcription factors
Transcription factor Regulation Reference
SP1 Unknown 12062800
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001515 Function Opioid peptide activity IEA
GO:0005184 Function Neuropeptide hormone activity TAS 10419552
GO:0005515 Function Protein binding IPI
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS 9521323
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601459 9163 ENSG00000168081
Protein
UniProt ID Q13519
Protein name Prepronociceptin [Cleaved into: Nocistatin; Nociceptin (Orphanin FQ) (PPNOC); Orphanin FQ2]
Protein function [Nociceptin]: Ligand of the opioid receptor-like receptor OPRL1. It may act as a transmitter in the brain by modulating nociceptive and locomotor behavior. May be involved in neuronal differentiation and development. {ECO:0000250|UniProtKB:P5579
PDB 8F7X
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01160 Opiods_neuropep 20 66 Vertebrate endogenous opioids neuropeptide Family
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in the brain and spinal cord. Also expressed and secreted by peripheral blood neutrophils following degranulation. {ECO:0000269|PubMed:12950177}.
Sequence
MKVLLCDLLLLSLFSSVFSSCQRDCLTCQEKLHPALDSFDLEVCILECEEKVFPSPLWTP
CTKVMA
RSSWQLSPAAPEHVAAALYQPRASEMQHLRRMPRVRSLFQEQEEPEPGMEEAGE
MEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQRRRTLHQNGNV
Sequence length 176
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Neuroactive ligand-receptor interaction
Hormone signaling
  Peptide ligand-binding receptors
G alpha (i) signalling events
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Anxiety Associate 28969474
Arthritis Infectious Associate 21324928
Breast Neoplasms Associate 35665772
Cholangiocarcinoma Associate 33841428
Chronic Pain Associate 21324928
Disorders of Excessive Somnolence Associate 33568662
Endometriosis Associate 37408230
Ganglioglioma Associate 22706982
Gastrointestinal Stromal Tumors Associate 29578181
Inflammation Associate 24066107