PNOC (prepronociceptin)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID 5368
Gene name Prepronociceptin
Gene symbol PNOC
Synonyms (NCBI Gene)
N/OFQNOPOFQPPNOCppN/OFQ
Chromosome 8
Chromosome location 8p21.1
Summary This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products. These products include nociceptin, nocistatin, and orphanin FQ2 (OFQ2). Nociceptin, also known as orphanin FQ, is a 17-amino acid neuropeptide that
miRNA miRNA information provided by mirtarbase database.
8
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (8)
miRTarBase ID miRNA Experiments Reference
MIRT029788 hsa-miR-26b-5p Microarray 19088304
MIRT1245313 hsa-miR-31 CLIP-seq
MIRT1245314 hsa-miR-3154 CLIP-seq
MIRT1245315 hsa-miR-3179 CLIP-seq
MIRT1245316 hsa-miR-3656 CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (1)
Transcription factor Regulation Reference
SP1 Unknown 12062800
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (22)
GO ID Ontology Definition Evidence Reference
GO:0001515 Function Opioid peptide activity IEA
GO:0005184 Function Neuropeptide hormone activity TAS 10419552
GO:0005515 Function Protein binding IPI
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS 9521323
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
601459 9163 ENSG00000168081
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q13519
Protein name Prepronociceptin [Cleaved into: Nocistatin; Nociceptin (Orphanin FQ) (PPNOC); Orphanin FQ2]
Protein function [Nociceptin]: Ligand of the opioid receptor-like receptor OPRL1. It may act as a transmitter in the brain by modulating nociceptive and locomotor behavior. May be involved in neuronal differentiation and development. {ECO:0000250|UniProtKB:P5579
PDB 8F7X
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01160 Opiods_neuropep 20 → 66 Vertebrate endogenous opioids neuropeptide Family
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in the brain and spinal cord. Also expressed and secreted by peripheral blood neutrophils following degranulation. {ECO:0000269|PubMed:12950177}.
Sequence 
MKVLLCDLLLLSLFSSVFSSCQRDCLTCQEKLHPALDSFDLEVCILECEEKVFPSPLWTP
CTKVMARSSWQLSPAAPEHVAAALYQPRASEMQHLRRMPRVRSLFQEQEEPEPGMEEAGE
MEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQRRRTLHQNGNV
Sequence length 176
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
  KEGG  Reactome
  Neuroactive ligand-receptor interaction
Hormone signaling 		  Peptide ligand-binding receptors
G alpha (i) signalling events