PMCH (pro-melanin concentrating hormone)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5367
Gene name Gene Name - the full gene name approved by the HGNC.
Pro-melanin concentrating hormone
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PMCH
Synonyms (NCBI Gene) Gene synonyms aliases
MCH, ppMCH
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q23.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products. These products include melanin-concentrating hormone (MCH), neuropeptide-glutamic acid-isoleucine (NEI), and neuropeptide-glycine-glutamic acid (NGE
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(9)
miRTarBase ID miRNA Experiments Reference
MIRT1244245 hsa-miR-182 CLIP-seq
MIRT1244246 hsa-miR-4279 CLIP-seq
MIRT2072151 hsa-miR-4719 CLIP-seq
MIRT2072152 hsa-miR-513b CLIP-seq
MIRT2072153 hsa-miR-561 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(14)
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region NAS 8326825
GO:0005576 Component Extracellular region TAS
GO:0005634 Component Nucleus IEA
GO:0007186 Process G protein-coupled receptor signaling pathway TAS
GO:0007218 Process Neuropeptide signaling pathway IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
176795 9109 ENSG00000183395
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P20382
Protein name Pro-MCH [Cleaved into: Neuropeptide-glycine-glutamic acid (NGE) (Neuropeptide G-E); Neuropeptide-glutamic acid-isoleucine (NEI) (Neuropeptide E-I); Melanin-concentrating hormone (MCH)]
Protein function MCH may act as a neurotransmitter or neuromodulator in a broad array of neuronal functions directed toward the regulation of goal-directed behavior, such as food intake, and general arousal. May also have a role in spermatocyte differentiation.
PDB 8WSS , 8WST , 8WWK , 8WWL , 8WWM , 8WWN
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05824 Pro-MCH 82 → 165 Pro-melanin-concentrating hormone (Pro-MCH) Family
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in lateral hypothalamus, also detected in pallidum, neocortex and cerebellum. Also found in thymus, brown adipose tissue, duodenum and testis (spermatogonia, early spermatocytes and Sertoli cells). No expression
Sequence 
MAKMNLSSYILILTFSLFSQGILLSASKSIRNLDDDMVFNTFRLGKGFQKEDTAEKSVIA
PSLEQYKNDESSFMNEEENKVSKNTGSKHNFLNHGLPLNLAIKPYLALKGSVAFPAENGV
QNTESTQEKREIGDEENSAKFPIGRRDFDMLRCMLGRVYRPCWQV
Sequence length 165
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Neuroactive ligand-receptor interaction
Hormone signaling 		  Peptide ligand-binding receptors
G alpha (q) signalling events
G alpha (i) signalling events
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Obesity Obesity rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562
View all (27 more)		 12355323
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Mental depression Mental Depression, Depressive disorder 16934771 ClinVar
Show/Hide Text Mining Associations (7)
Associations from Text Mining
Disease Name Relationship Type References
Asthma Associate 17640905, 32460303
HELLP Syndrome Associate 23093777
Lymphoma Follicular Associate 23775959
Obesity Associate 17640905
Rhinitis Associate 32460303
Rotator Cuff Injuries Associate 30424787
Vitiligo Associate 11927619