Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	53637
Gene name	Sphingosine-1-phosphate receptor 5
Gene symbol	S1PR5
Synonyms (NCBI Gene)	EDG8Edg-8S1P5SPPR-1SPPR-2
Chromosome	19
Chromosome location	19p13.2
Summary	The lysosphingolipid sphingosine 1-phosphate (S1P) regulates cell proliferation, apoptosis, motility, and neurite retraction. Its actions may be both intracellular as a second messenger and extracellular as a receptor ligand. S1P and the structurally rela

Show/Hide all (76)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023008	hsa-miR-124-3p	Microarray	18668037
MIRT1324555	hsa-miR-1321	CLIP-seq
MIRT1324556	hsa-miR-133a	CLIP-seq
MIRT1324557	hsa-miR-133b	CLIP-seq
MIRT1324558	hsa-miR-1915	CLIP-seq
MIRT1324559	hsa-miR-2114	CLIP-seq
MIRT1324560	hsa-miR-3162-5p	CLIP-seq
MIRT1324561	hsa-miR-3929	CLIP-seq
MIRT1324562	hsa-miR-4419b	CLIP-seq
MIRT1324563	hsa-miR-4433	CLIP-seq
MIRT1324564	hsa-miR-4436a	CLIP-seq
MIRT1324565	hsa-miR-4478	CLIP-seq
MIRT1324566	hsa-miR-4645-5p	CLIP-seq
MIRT1324567	hsa-miR-4673	CLIP-seq
MIRT1324568	hsa-miR-4726-3p	CLIP-seq
MIRT1324569	hsa-miR-4739	CLIP-seq
MIRT1324570	hsa-miR-4756-5p	CLIP-seq
MIRT1324571	hsa-miR-485-5p	CLIP-seq
MIRT1324572	hsa-miR-610	CLIP-seq
MIRT1324573	hsa-miR-665	CLIP-seq
MIRT1553213	hsa-miR-1226	CLIP-seq
MIRT1553214	hsa-miR-338-3p	CLIP-seq
MIRT1553215	hsa-miR-4269	CLIP-seq
MIRT1324566	hsa-miR-4645-5p	CLIP-seq
MIRT1324567	hsa-miR-4673	CLIP-seq
MIRT1553216	hsa-miR-634	CLIP-seq
MIRT2096370	hsa-miR-150	CLIP-seq
MIRT1324558	hsa-miR-1915	CLIP-seq
MIRT2096371	hsa-miR-3159	CLIP-seq
MIRT2096372	hsa-miR-331-3p	CLIP-seq
MIRT2096373	hsa-miR-3679-3p	CLIP-seq
MIRT2096374	hsa-miR-4257	CLIP-seq
MIRT1324563	hsa-miR-4433	CLIP-seq
MIRT1324566	hsa-miR-4645-5p	CLIP-seq
MIRT1324567	hsa-miR-4673	CLIP-seq
MIRT2096375	hsa-miR-4713-5p	CLIP-seq
MIRT1324568	hsa-miR-4726-3p	CLIP-seq
MIRT2096376	hsa-miR-532-3p	CLIP-seq
MIRT2096377	hsa-miR-548a-3p	CLIP-seq
MIRT2096378	hsa-miR-548e	CLIP-seq
MIRT2096379	hsa-miR-548f	CLIP-seq
MIRT1324572	hsa-miR-610	CLIP-seq
MIRT2096380	hsa-miR-627	CLIP-seq
MIRT2096381	hsa-miR-647	CLIP-seq
MIRT1324573	hsa-miR-665	CLIP-seq
MIRT2096382	hsa-miR-924	CLIP-seq
MIRT2320556	hsa-miR-125a-5p	CLIP-seq
MIRT2320557	hsa-miR-125b	CLIP-seq
MIRT2320558	hsa-miR-148a	CLIP-seq
MIRT2320559	hsa-miR-148b	CLIP-seq
MIRT2320560	hsa-miR-152	CLIP-seq
MIRT1324558	hsa-miR-1915	CLIP-seq
MIRT1324559	hsa-miR-2114	CLIP-seq
MIRT2320561	hsa-miR-2467-3p	CLIP-seq
MIRT2320562	hsa-miR-3158-5p	CLIP-seq
MIRT2096371	hsa-miR-3159	CLIP-seq
MIRT2320563	hsa-miR-3678-3p	CLIP-seq
MIRT2320564	hsa-miR-3944-5p	CLIP-seq
MIRT2320565	hsa-miR-4289	CLIP-seq
MIRT2320566	hsa-miR-4319	CLIP-seq
MIRT1324563	hsa-miR-4433	CLIP-seq
MIRT1324566	hsa-miR-4645-5p	CLIP-seq
MIRT1324567	hsa-miR-4673	CLIP-seq
MIRT1324568	hsa-miR-4726-3p	CLIP-seq
MIRT2320567	hsa-miR-4732-3p	CLIP-seq
MIRT2096380	hsa-miR-627	CLIP-seq
MIRT2320568	hsa-miR-640	CLIP-seq
MIRT2096381	hsa-miR-647	CLIP-seq
MIRT1324573	hsa-miR-665	CLIP-seq
MIRT2320569	hsa-miR-670	CLIP-seq
MIRT2096382	hsa-miR-924	CLIP-seq
MIRT1324555	hsa-miR-1321	CLIP-seq
MIRT1324559	hsa-miR-2114	CLIP-seq
MIRT1324560	hsa-miR-3162-5p	CLIP-seq
MIRT1324569	hsa-miR-4739	CLIP-seq
MIRT1324570	hsa-miR-4756-5p	CLIP-seq

Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003376	Process	Sphingosine-1-phosphate receptor signaling pathway	IEA
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0016020	Component	Membrane	IEA
GO:0038036	Function	Sphingosine-1-phosphate receptor activity	IEA
GO:0098793	Component	Presynapse	IEA

MIM	HGNC	e!Ensembl
605146	14299	ENSG00000180739

Q9H228

Protein name

Sphingosine 1-phosphate receptor 5 (S1P receptor 5) (S1P5) (Endothelial differentiation G-protein-coupled receptor 8) (Sphingosine 1-phosphate receptor Edg-8) (S1P receptor Edg-8)

Protein function

Receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. Is coupled to both the G(i/0)alpha and G(12) subclass of heteromer

PDB

7EW1 , 7YXA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	53 → 306	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed in the brain, most prominently in the corpus callosum, which is predominantly white matter. Detected in spleen, peripheral blood leukocytes, placenta, lung, aorta and fetal spleen. Low-level signal detected in many tis

Sequence

MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFIVLENLAVLLV
LGRHPRFHAPMFLLLGSLTLSDLLAGAAYAANILLSGPLTLKLSPALWFAREGGVFVALT
ASVLSLLAIALERSLTMARRGPAPVSSRGRTLAMAAAAWGVSLLLGLLPALGWNCLGRLD
ACSTVLPLYAKAYVLFCVLAFVGILAAICALYARIYCQVRANARRLPARPGTAGTTSTRA
RRKPRSLALLRTLSVVLLAFVACWGPLFLLLLLDVACPARTCPVLLQADPFLGLAMANSL
LNPIIYTLTNRDLRHALLRLVCCGRHSCGRDPSGSQQSASAAEASGGLRRCLPPGLDGSF
SGSERSSPQRDGLDTSGSTGSPGAPTAARTLVSEPAAD

Sequence length

398

Interactions

View interactions

	KEGG		Reactome
	Sphingolipid signaling pathway Neuroactive ligand-receptor interaction		G alpha (i) signalling events Lysosphingolipid and LPA receptors

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLERODERMA, SYSTEMIC	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (12)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Endometriosis	Associate	32907751	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Associate	24903384	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Inhibit	22715976	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	18477771	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Associate	38287231	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Stimulate	34092610	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Associate	32322257	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	25084322	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Associate	20950786	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Associate	34536521	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Associate	26485657	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Associate	36214715	★★★★★ ★☆☆☆☆ Found in Text Mining only

S1PR5 (sphingosine-1-phosphate receptor 5)