Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
533
Gene name Gene Name - the full gene name approved by the HGNC.
ATPase H+ transporting V0 subunit b
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ATP6V0B
Synonyms (NCBI Gene) Gene synonyms aliases
ATP6F, HATPL, VMA16
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p34.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a portion of the V0 domain of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. Activity of this enzyme is necessary for such varied processes as protein sorting, zymoge
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT341458 hsa-miR-548aa PAR-CLIP 23592263
MIRT341461 hsa-miR-548ap-3p PAR-CLIP 23592263
MIRT341455 hsa-miR-548t-3p PAR-CLIP 23592263
MIRT452083 hsa-miR-548n PAR-CLIP 23592263
MIRT341462 hsa-miR-548az-5p PAR-CLIP 23592263
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005215 Function Transporter activity TAS 9653649
GO:0005515 Function Protein binding IPI 32296183
GO:0005774 Component Vacuolar membrane IEA
GO:0008286 Process Insulin receptor signaling pathway TAS
GO:0010008 Component Endosome membrane TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603717 861 ENSG00000117410
Protein
UniProt ID Q99437
Protein name V-type proton ATPase 21 kDa proteolipid subunit c'' (V-ATPase 21 kDa proteolipid subunit c'') (Vacuolar proton pump 21 kDa proteolipid subunit c'') (hATPL)
Protein function Proton-conducting pore forming subunit of the V0 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons (PubMed:33
PDB 6WLW , 6WM2 , 6WM3 , 6WM4 , 7U4T , 7UNF
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00137 ATP-synt_C 52 111 ATP synthase subunit C Family
PF00137 ATP-synt_C 138 197 ATP synthase subunit C Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous.
Sequence
MTGLALLYSGVFVAFWACALAVGVCYTIFDLGFRFDVAWFLTETSPFMWSNLGIGLAISL
SVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVI
SNMAEPFSA
TDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKILIVE
IFGSAIGLFGVIVAILQ
TSRVKMGD
Sequence length 205
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Oxidative phosphorylation
Metabolic pathways
Lysosome
Phagosome
Synaptic vesicle cycle
Vibrio cholerae infection
Epithelial cell signaling in Helicobacter pylori infection
Tuberculosis
Human papillomavirus infection
Rheumatoid arthritis
  ROS and RNS production in phagocytes
Insulin receptor recycling
Transferrin endocytosis and recycling
Amino acids regulate mTORC1
Ion channel transport
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
Unknown
Disease term Disease name Evidence References Source
Schizophrenia Schizophrenia GWAS
Associations from Text Mining
Disease Name Relationship Type References
Bronchopulmonary Dysplasia Associate 23295978
Cafe au Lait Spots Associate 25329635
Carcinoma Hepatocellular Associate 36105252, 36458010