Gene Gene information from NCBI Gene database.
Entrez ID 533
Gene name ATPase H+ transporting V0 subunit b
Gene symbol ATP6V0B
Synonyms (NCBI Gene)
ATP6FHATPLVMA16
Chromosome 1
Chromosome location 1p34.1
Summary This gene encodes a portion of the V0 domain of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. Activity of this enzyme is necessary for such varied processes as protein sorting, zymoge
miRNA miRNA information provided by mirtarbase database.
229
miRTarBase ID miRNA Experiments Reference
MIRT341458 hsa-miR-548aa PAR-CLIP 23592263
MIRT341461 hsa-miR-548ap-3p PAR-CLIP 23592263
MIRT341455 hsa-miR-548t-3p PAR-CLIP 23592263
MIRT452083 hsa-miR-548n PAR-CLIP 23592263
MIRT341462 hsa-miR-548az-5p PAR-CLIP 23592263
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
33
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane NAS 32001091
GO:0000220 Component Vacuolar proton-transporting V-type ATPase, V0 domain ISS
GO:0005515 Function Protein binding IPI 32296183
GO:0005765 Component Lysosomal membrane NAS 32001091
GO:0005765 Component Lysosomal membrane TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603717 861 ENSG00000117410
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q99437
Protein name V-type proton ATPase 21 kDa proteolipid subunit c'' (V-ATPase 21 kDa proteolipid subunit c'') (Vacuolar proton pump 21 kDa proteolipid subunit c'') (hATPL)
Protein function Proton-conducting pore forming subunit of the V0 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons (PubMed:33
PDB 6WLW , 6WM2 , 6WM3 , 6WM4 , 7U4T , 7UNF
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00137 ATP-synt_C 52 111 ATP synthase subunit C Family
PF00137 ATP-synt_C 138 197 ATP synthase subunit C Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous.
Sequence
MTGLALLYSGVFVAFWACALAVGVCYTIFDLGFRFDVAWFLTETSPFMWSNLGIGLAISL
SVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVI
SNMAEPFSA
TDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKILIVE
IFGSAIGLFGVIVAILQ
TSRVKMGD
Sequence length 205
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Oxidative phosphorylation
Metabolic pathways
Lysosome
Phagosome
Synaptic vesicle cycle
Vibrio cholerae infection
Epithelial cell signaling in Helicobacter pylori infection
Tuberculosis
Human papillomavirus infection
Rheumatoid arthritis
  ROS and RNS production in phagocytes
Insulin receptor recycling
Transferrin endocytosis and recycling
Amino acids regulate mTORC1
Ion channel transport