Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5289
Gene name Gene Name - the full gene name approved by the HGNC.	Phosphatidylinositol 3-kinase catalytic subunit type 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PIK3C3
Synonyms (NCBI Gene) Gene synonyms aliases	VPS34, Vps34, hVps34
Chromosome Chromosome number	18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	18q12.3

Show/Hide all(64)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027827	hsa-miR-98-5p	Microarray	19088304
MIRT045507	hsa-miR-149-5p	CLASH	23622248
MIRT497909	hsa-miR-5583-3p	PAR-CLIP	22291592
MIRT497908	hsa-miR-5579-5p	PAR-CLIP	22291592
MIRT497907	hsa-miR-4635	PAR-CLIP	22291592
MIRT497906	hsa-miR-4699-5p	PAR-CLIP	22291592
MIRT497905	hsa-miR-3148	PAR-CLIP	22291592
MIRT497904	hsa-miR-6124	PAR-CLIP	22291592
MIRT497903	hsa-miR-4709-3p	PAR-CLIP	22291592
MIRT497902	hsa-miR-3978	PAR-CLIP	22291592
MIRT737331	hsa-miR-340-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), RNA-seq, qRT-PCR	32207410
MIRT497909	hsa-miR-5583-3p	PAR-CLIP	22291592
MIRT497908	hsa-miR-5579-5p	PAR-CLIP	22291592
MIRT497907	hsa-miR-4635	PAR-CLIP	22291592
MIRT497906	hsa-miR-4699-5p	PAR-CLIP	22291592
MIRT497905	hsa-miR-3148	PAR-CLIP	22291592
MIRT497904	hsa-miR-6124	PAR-CLIP	22291592
MIRT497903	hsa-miR-4709-3p	PAR-CLIP	22291592
MIRT497902	hsa-miR-3978	PAR-CLIP	22291592
MIRT2295965	hsa-miR-3682-5p	CLIP-seq
MIRT2295966	hsa-miR-421	CLIP-seq
MIRT2295967	hsa-miR-4680-5p	CLIP-seq
MIRT2295968	hsa-miR-4691-5p	CLIP-seq
MIRT2295969	hsa-miR-4775	CLIP-seq
MIRT2593936	hsa-miR-1236	CLIP-seq
MIRT2593937	hsa-miR-138	CLIP-seq
MIRT2593938	hsa-miR-2054	CLIP-seq
MIRT2593939	hsa-miR-300	CLIP-seq
MIRT2593940	hsa-miR-323b-3p	CLIP-seq
MIRT2593941	hsa-miR-3664-5p	CLIP-seq
MIRT2593942	hsa-miR-380	CLIP-seq
MIRT2593943	hsa-miR-381	CLIP-seq
MIRT2593944	hsa-miR-3913-3p	CLIP-seq
MIRT2593945	hsa-miR-409-5p	CLIP-seq
MIRT2593946	hsa-miR-4268	CLIP-seq
MIRT2593947	hsa-miR-4448	CLIP-seq
MIRT2593948	hsa-miR-4666-3p	CLIP-seq
MIRT2593949	hsa-miR-4714-5p	CLIP-seq
MIRT2593950	hsa-miR-4753-3p	CLIP-seq
MIRT2593951	hsa-miR-4768-5p	CLIP-seq
MIRT2593952	hsa-miR-489	CLIP-seq
MIRT2593953	hsa-miR-502-5p	CLIP-seq
MIRT2593954	hsa-miR-510	CLIP-seq
MIRT2593955	hsa-miR-515-5p	CLIP-seq
MIRT2593956	hsa-miR-520d-5p	CLIP-seq
MIRT2593957	hsa-miR-524-5p	CLIP-seq
MIRT2593936	hsa-miR-1236	CLIP-seq
MIRT2593937	hsa-miR-138	CLIP-seq
MIRT2593938	hsa-miR-2054	CLIP-seq
MIRT2593939	hsa-miR-300	CLIP-seq
MIRT2593940	hsa-miR-323b-3p	CLIP-seq
MIRT2593941	hsa-miR-3664-5p	CLIP-seq
MIRT2593942	hsa-miR-380	CLIP-seq
MIRT2593943	hsa-miR-381	CLIP-seq
MIRT2593944	hsa-miR-3913-3p	CLIP-seq
MIRT2593945	hsa-miR-409-5p	CLIP-seq
MIRT2593948	hsa-miR-4666-3p	CLIP-seq
MIRT2593949	hsa-miR-4714-5p	CLIP-seq
MIRT2593950	hsa-miR-4753-3p	CLIP-seq
MIRT2593951	hsa-miR-4768-5p	CLIP-seq
MIRT2593952	hsa-miR-489	CLIP-seq
MIRT2593953	hsa-miR-502-5p	CLIP-seq
MIRT2593954	hsa-miR-510	CLIP-seq
MIRT2593955	hsa-miR-515-5p	CLIP-seq

Show/Hide all(39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000045	Process	Autophagosome assembly	IBA	21873635
GO:0000407	Component	Phagophore assembly site	IBA	21873635
GO:0005515	Function	Protein binding	IPI	7504174, 14617358, 16417406, 19050071, 19270696, 20142477, 20562859, 21062745, 22095288, 22493499, 23316280, 23332761, 23364696, 23878393, 23954414, 24034250, 24056303, 24472739, 24785657, 24849286, 25490155, 25594178, 26496610, 26783301, 28479384, 28514442, 31806350
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005768	Component	Endosome	IBA	21873635
GO:0005770	Component	Late endosome	IDA	14617358
GO:0005777	Component	Peroxisome	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0005930	Component	Axoneme	ISS
GO:0006497	Process	Protein lipidation	IMP	25327288
GO:0006661	Process	Phosphatidylinositol biosynthetic process	TAS
GO:0006897	Process	Endocytosis	IBA	21873635
GO:0006914	Process	Autophagy	IMP	25327288
GO:0007049	Process	Cell cycle	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IBA	21873635
GO:0016236	Process	Macroautophagy	ISS
GO:0016236	Process	Macroautophagy	TAS
GO:0016301	Function	Kinase activity	IDA	25327288
GO:0016303	Function	1-phosphatidylinositol-3-kinase activity	IBA	21873635
GO:0016303	Function	1-phosphatidylinositol-3-kinase activity	IMP	20208530
GO:0016303	Function	1-phosphatidylinositol-3-kinase activity	TAS
GO:0030242	Process	Autophagy of peroxisome	IBA	21873635
GO:0030496	Component	Midbody	IDA	20208530
GO:0030670	Component	Phagocytic vesicle membrane	TAS
GO:0032465	Process	Regulation of cytokinesis	IMP	20208530, 20643123
GO:0034162	Process	Toll-like receptor 9 signaling pathway	TAS
GO:0034271	Component	Phosphatidylinositol 3-kinase complex, class III, type I	IBA	21873635
GO:0034272	Component	Phosphatidylinositol 3-kinase complex, class III, type II	IBA	21873635
GO:0035032	Component	Phosphatidylinositol 3-kinase complex, class III	ISS
GO:0036092	Process	Phosphatidylinositol-3-phosphate biosynthetic process	IBA	21873635
GO:0042149	Process	Cellular response to glucose starvation	ISS
GO:0044754	Component	Autolysosome	IDA	25327288
GO:0045022	Process	Early endosome to late endosome transport	IMP	14617358
GO:0046854	Process	Phosphatidylinositol phosphorylation	IBA	21873635
GO:0048015	Process	Phosphatidylinositol-mediated signaling	IBA	21873635
GO:0051301	Process	Cell division	IEA
GO:0052742	Function	Phosphatidylinositol kinase activity	IBA	21873635

MIM	HGNC	e!Ensembl
602609	8974	ENSG00000078142

Protein

UniProt ID

Q8NEB9

Protein name

Phosphatidylinositol 3-kinase catalytic subunit type 3 (PI3-kinase type 3) (PI3K type 3) (PtdIns-3-kinase type 3) (EC 2.7.1.137) (Phosphatidylinositol 3-kinase p100 subunit) (Phosphoinositide-3-kinase class 3) (hVps34)

Protein function

Catalytic subunit of the PI3K complex that mediates formation of phosphatidylinositol 3-phosphate; different complex forms are believed to play a role in multiple membrane trafficking pathways: PI3KC3-C1 is involved in initiation of autophagosom

PDB

3IHY , 3LS8 , 4OYS , 4PH4 , 4UWF , 4UWG , 4UWH , 4UWK , 4UWL , 5ANL , 5ENN , 6HOG , 6HOH , 6I3U , 6YKG , 7BL1 , 7RSJ , 7RSP , 7RSV , 8RXR , 8SOR , 9C82 , 9E4V , 9MHF , 9MHG , 9MHH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00792	PI3K_C2	53 → 198	Phosphoinositide 3-kinase C2	Domain
PF00613	PI3Ka	284 → 530	Phosphoinositide 3-kinase family, accessory domain (PIK domain)	Family
PF00454	PI3_PI4_kinase	630 → 702	Phosphatidylinositol 3- and 4-kinase	Family
PF00454	PI3_PI4_kinase	689 → 833	Phosphatidylinositol 3- and 4-kinase	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed, with a highest expression in skeletal muscle. {ECO:0000269|PubMed:7628435}.

Sequence

MGEAEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVT
CQVFAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAV
PVGGTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGRTSSTLSEDQMSRLAKLTK
AHRQGHMVKVDWLDRLTFREIEMINESEKRSSNFMYLMVEFRCVKCDDKEYGIVYYEKDG
DESSPILTSFELVKVPDPQMSMENLVESKHHKLARSLRSGPSDHDLKPNAATRDQLNIIV
SYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCVNWDLPQEAKQALELLGKWKPMDV
EDSLELLSSHYTNPTVRRYAVARLRQADDEDLLMYLLQLVQALKYENFDDIKNGLEPTKK
DSQSSVSENVSNSGINSAEIDSSQIITSPLPSVSSPPPASKTKEVPDGENLEQDLCTFLI
SRACKNSTLANYLYWYVIVECEDQDTQQRDPKTHEMYLNVMRRFSQALLKGDKSVRVMRS
LLAAQQTFVDRLVHLMKAVQRESGNRKKKNERLQALLGDNEKMNLSDVELIPLPLEPQVK
IRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKHGDDLRQDQLILQIISLMDKLLRK
ENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEGSIQNFFRKYAPSENGPNGISAE
VMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPPPMKLN
KEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVK
KVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK

Sequence length

887

Interactions

View interactions

	KEGG		Reactome
	Inositol phosphate metabolism Metabolic pathways Phosphatidylinositol signaling system Autophagy - other Autophagy - animal Phagosome Apelin signaling pathway Alzheimer disease Amyotrophic lateral sclerosis Huntington disease Spinocerebellar ataxia Pathways of neurodegeneration - multiple diseases Shigellosis Salmonella infection Tuberculosis Kaposi sarcoma-associated herpesvirus infection		PI3K Cascade Macroautophagy Synthesis of PIPs at the Golgi membrane Synthesis of PIPs at the early endosome membrane Synthesis of PIPs at the late endosome membrane Toll Like Receptor 9 (TLR9) Cascade RHO GTPases Activate NADPH Oxidases

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	18420347, 15814194, 15121481

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Source
Unknown
Asthma	Asthma	GWAS
Metabolic Syndrome	Metabolic Syndrome	GWAS
Periodontal Diseases	Periodontal Diseases	GWAS

Show/Hide Text Mining Associations (20)

Disease Name	Relationship Type	References
Associations from Text Mining
Alzheimer Disease	Associate	20559548
Autoimmune Diseases	Associate	20671926
Breast Neoplasms	Associate	24818135, 34870550
Colorectal Neoplasms	Associate	31092562, 33846805
Esophageal Squamous Cell Carcinoma	Associate	18649358, 32207410, 35333349
Hyperinsulinism	Associate	25042561
Hypoxia	Associate	32833964, 35626732
Leukemia	Associate	30381299
Lupus Erythematosus Systemic	Associate	20671926
Lymphoma Non Hodgkin	Associate	38203743
Neoplasm Metastasis	Associate	26537687
Neoplasms	Associate	20513426, 20634405, 24818135, 26537687, 26637440, 32833964
Neoplasms	Inhibit	32207410
Neurodegenerative Diseases	Associate	20513426
Ovarian Neoplasms	Associate	20508647
Prostatic Neoplasms	Associate	20406981
Rhinitis Allergic	Associate	39528529
Sepsis	Associate	28296904
Spastic paraplegia 11 autosomal recessive	Associate	30081747
Spastic paraplegia 15 autosomal recessive	Associate	30081747

PIK3C3 (phosphatidylinositol 3-kinase catalytic subunit type 3)