Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5283
Gene name Gene Name - the full gene name approved by the HGNC.
Phosphatidylinositol glycan anchor biosynthesis class H
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PIGH
Synonyms (NCBI Gene) Gene synonyms aliases
GPI-H
Chromosome Chromosome number
14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q24.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes an endoplasmic reticulum associated protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI anchor is a glycolipid found on many blood cells and which serves to anchor proteins to the cell surface. The
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs776038451 A>G Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT025861 hsa-miR-7-5p Microarray 17612493
MIRT450755 hsa-miR-2682-3p PAR-CLIP 22100165
MIRT450754 hsa-miR-6781-3p PAR-CLIP 22100165
MIRT450755 hsa-miR-2682-3p PAR-CLIP 22100165
MIRT450754 hsa-miR-6781-3p PAR-CLIP 22100165
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000506 Component Glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex IBA
GO:0000506 Component Glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex IDA 10944123, 16162815
GO:0000506 Component Glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex IEA
GO:0000506 Component Glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex IPI 16162815
GO:0003824 Function Catalytic activity TAS 8900170
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600154 8964 ENSG00000100564
Protein
UniProt ID Q14442
Protein name Phosphatidylinositol N-acetylglucosaminyltransferase subunit H (Phosphatidylinositol-glycan biosynthesis class H protein) (PIG-H)
Protein function Part of the glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex that catalyzes the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol and participates in the first step of GPI biosynth
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF10181 PIG-H 89 158 GPI-GlcNAc transferase complex, PIG-H component Family
Sequence
MEDERSFSDICGGRLALQRRYYSPSCREFCLSCPRLSLRSLTAVTCTVWLAAYGLFTLCE
NSMILSAAIFITLLGLLGYLHFVKIDQETLLIIDSLGIQMTSSYASGKESTTFIEMGKVK
DIVINEAIYMQKVIYYLCILLKDPVEPHGISQVVPVFQ
SAKPRLDCLIEVYRSCQEILAH
QKATSTSP
Sequence length 188
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
Metabolic pathways
  Synthesis of glycosylphosphatidylinositol (GPI)
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Glycosylphosphatidylinositol deficiency glycosylphosphatidylinositol biosynthesis defect 17 rs761543313, rs776038451 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Breast cancer (survival) N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Developmental Disabilities Associate 33156547
Fractures Bone Associate 33156547
Immunologic Deficiency Syndromes Associate 33156547
Intellectual Disability Associate 33156547
Mobility Limitation Associate 33156547
Muscle Hypotonia Associate 33156547
Precursor B Cell Lymphoblastic Leukemia Lymphoma Associate 30370942
Precursor Cell Lymphoblastic Leukemia Lymphoma Associate 30370942
Psychomotor Disorders Associate 33156547
Scoliosis Associate 33156547