Gene Gene information from NCBI Gene database.
Entrez ID 5283
Gene name Phosphatidylinositol glycan anchor biosynthesis class H
Gene symbol PIGH
Synonyms (NCBI Gene)
GPI-H
Chromosome 14
Chromosome location 14q24.1
Summary This gene encodes an endoplasmic reticulum associated protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI anchor is a glycolipid found on many blood cells and which serves to anchor proteins to the cell surface. The
SNPs SNP information provided by dbSNP.
1
SNP ID Visualize variation Clinical significance Consequence
rs776038451 A>G Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
198
miRTarBase ID miRNA Experiments Reference
MIRT025861 hsa-miR-7-5p Microarray 17612493
MIRT450755 hsa-miR-2682-3p PAR-CLIP 22100165
MIRT450754 hsa-miR-6781-3p PAR-CLIP 22100165
MIRT450755 hsa-miR-2682-3p PAR-CLIP 22100165
MIRT450754 hsa-miR-6781-3p PAR-CLIP 22100165
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15
GO ID Ontology Definition Evidence Reference
GO:0000506 Component Glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex IBA
GO:0000506 Component Glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex IDA 10944123, 16162815
GO:0000506 Component Glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex IEA
GO:0000506 Component Glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex IPI 16162815
GO:0003824 Function Catalytic activity TAS 8900170
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600154 8964 ENSG00000100564
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q14442
Protein name Phosphatidylinositol N-acetylglucosaminyltransferase subunit H (Phosphatidylinositol-glycan biosynthesis class H protein) (PIG-H)
Protein function Part of the glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex that catalyzes the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol and participates in the first step of GPI biosynth
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF10181 PIG-H 89 158 GPI-GlcNAc transferase complex, PIG-H component Family
Sequence
MEDERSFSDICGGRLALQRRYYSPSCREFCLSCPRLSLRSLTAVTCTVWLAAYGLFTLCE
NSMILSAAIFITLLGLLGYLHFVKIDQETLLIIDSLGIQMTSSYASGKESTTFIEMGKVK
DIVINEAIYMQKVIYYLCILLKDPVEPHGISQVVPVFQ
SAKPRLDCLIEVYRSCQEILAH
QKATSTSP
Sequence length 188
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
Metabolic pathways
  Synthesis of glycosylphosphatidylinositol (GPI)
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
12
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Glycosylphosphatidylinositol biosynthesis defect 17 Pathogenic rs761543313, rs776038451 RCV000656656
RCV000656657
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
PIGH-related disorder Conflicting classifications of pathogenicity; Benign; Likely benign rs370763975, rs190869461, rs150966448, rs28521930, rs45474396, rs10134513, rs201381653 RCV003416465
RCV003938922
RCV003929050
RCV003919788
RCV003973923
RCV003914591
RCV003942239
Prostate cancer Uncertain significance rs193920948 RCV000149159
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Developmental Disabilities Associate 33156547
Fractures Bone Associate 33156547
Immunologic Deficiency Syndromes Associate 33156547
Intellectual Disability Associate 33156547
Mobility Limitation Associate 33156547
Muscle Hypotonia Associate 33156547
Precursor B Cell Lymphoblastic Leukemia Lymphoma Associate 30370942
Precursor Cell Lymphoblastic Leukemia Lymphoma Associate 30370942
Psychomotor Disorders Associate 33156547
Scoliosis Associate 33156547