Gene Gene information from NCBI Gene database.
Entrez ID 5241
Gene name Progesterone receptor
Gene symbol PGR
Synonyms (NCBI Gene)
NR3C3PR
Chromosome 11
Chromosome location 11q22.1
Summary This gene encodes a member of the steroid receptor superfamily. The encoded protein mediates the physiological effects of progesterone, which plays a central role in reproductive events associated with the establishment and maintenance of pregnancy. This
miRNA miRNA information provided by mirtarbase database.
760
miRTarBase ID miRNA Experiments Reference
MIRT021282 hsa-miR-126-3p Reporter assay;Western blot 21526342
MIRT052993 hsa-miR-181a-5p Luciferase reporter assayqRT-PCRWestern blot 22492871
MIRT731058 hsa-miR-378a-3p qRT-PCRLuciferase reporter assayWestern blot 25150622
MIRT731058 hsa-miR-378a-3p qRT-PCRLuciferase reporter assayWestern blot 25150622
MIRT731058 hsa-miR-378a-3p qRT-PCRLuciferase reporter assayWestern blot 25150622
Transcription factors Transcription factors information provided by TRRUST V2 database.
9
Transcription factor Regulation Reference
ESR1 Activation 10894148;12554765
ESR1 Unknown 10835496
FOS Unknown 14684847
HOXA5 Activation 10875927
JUN Repression 14684847
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
62
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin IBA
GO:0000785 Component Chromatin IDA 37478846
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 17785366
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607311 8910 ENSG00000082175
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P06401
Protein name Progesterone receptor (PR) (Nuclear receptor subfamily 3 group C member 3)
Protein function The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Depending on the isoform, progesterone receptor functions as a transcr
PDB 1A28 , 1E3K , 1SQN , 1SR7 , 1ZUC , 2C7A , 2OVH , 2OVM , 2W8Y , 3D90 , 3G8O , 3HQ5 , 3KBA , 3ZR7 , 3ZRA , 3ZRB , 4A2J , 4APU , 4OAR , 5CC0
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02161 Prog_receptor 1 564 Progesterone receptor Family
PF00105 zf-C4 565 634 Zinc finger, C4 type (two domains) Domain
PF00104 Hormone_recep 704 891 Ligand-binding domain of nuclear hormone receptor Domain
Tissue specificity TISSUE SPECIFICITY: In reproductive tissues the expression of isoform A and isoform B varies as a consequence of developmental and hormonal status. Isoform A and isoform B are expressed in comparable levels in uterine glandular epithelium during the proli
Sequence
MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLF
PRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGLLDSVLDTLLA
PSGPGQSQPSPPACEVTSSWCLFGPELPEDPPAAPATQRVLSPLMSRSGCKVGDSSGTAA
AHKVLPRGLSPARQLLLPASESPHWSGAPVKPSPQAAAVEVEEEDGSESEESAGPLLKGK
PRALGGAAAGGGAAAVPPGAAAGGVALVPKEDSRFSAPRVALVEQDAPMAPGRSPLATTV
MDFIHVPILPLNHALLAARTRQLLEDESYDGGAGAASAFAPPRSSPCASSTPVAVGDFPD
CAYPPDAEPKDDAYPLYSDFQPPALKIKEEEEGAEASARSPRSYLVAGANPAAFPDFPLG
PPPPLPPRATPSRPGEAAVTAAPASASVSSASSSGSTLECILYKAEGAPPQQGPFAPPPC
KAPGASGCLLPRDGLPSTSASAAAAGAAPALYPALGLNGLPQLGYQAAVLKEGLPQVYPP
YLNYLRPDSEASQSPQYSFESLPQ
KICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHN
YLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVL
GGRKFKKFNKVRVVRALDAVALPQPV
GVPNESQALSQRFTFSPGQDIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQ
LGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAP
DLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQ
FEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYC
LNTFIQSRA
LSVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK
Sequence length 933
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Oocyte meiosis
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Chemical carcinogenesis - receptor activation
Breast cancer
  Nuclear signaling by ERBB4
HSP90 chaperone cycle for steroid hormone receptors (SHR)
Nuclear Receptor transcription pathway
SUMOylation of intracellular receptors
Estrogen-dependent gene expression
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Thyroid cancer, nonmedullary, 1 Benign; Likely benign rs201378964 RCV005908568
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Abortion Spontaneous Associate 12009358
Acquired Immunodeficiency Syndrome Associate 20415450, 24069209, 24498124
Acute Phase Reaction Associate 27960568
Acute Phase Reaction Stimulate 8774273
Adenocarcinoma Associate 16601283, 23706170, 23719407, 29851704
Adenocarcinoma Mucinous Associate 21699710, 22990556
Adenocarcinoma of Lung Associate 19706809, 19875972, 34550610
Adenoma Associate 38404080
Adenoma Pleomorphic Stimulate 12001119
Adenomatous Polyps Associate 8504960