Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5229
Gene name Gene Name - the full gene name approved by the HGNC.
Protein geranylgeranyltransferase type I subunit beta
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PGGT1B
Synonyms (NCBI Gene) Gene synonyms aliases
BGGI, GGTI
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q22.3
Summary Summary of gene provided in NCBI Entrez Gene.
Protein geranylgeranyltransferase type I (GGTase-I) transfers a geranylgeranyl group to the cysteine residue of candidate proteins containing a C-terminal CAAX motif in which `A` is an aliphatic amino acid and `X` is leucine (summarized by Zhang et al., 1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022675 hsa-miR-124-3p Microarray 18668037
MIRT053412 hsa-miR-591 Microarray 23807165
MIRT438832 hsa-miR-582-5p qRT-PCR 23295946
MIRT438821 hsa-miR-582-3p qRT-PCR 23295946
MIRT438832 hsa-miR-582-5p qRT-PCR 23295946
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003824 Function Catalytic activity IEA
GO:0004659 Function Prenyltransferase activity IEA
GO:0004661 Function Protein geranylgeranyltransferase activity IDA 16893176
GO:0004661 Function Protein geranylgeranyltransferase activity IEA
GO:0004662 Function CAAX-protein geranylgeranyltransferase activity IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602031 8895 ENSG00000164219
Protein
UniProt ID P53609
Protein name Geranylgeranyl transferase type-1 subunit beta (EC 2.5.1.59) (Geranylgeranyl transferase type I subunit beta) (GGTase-I-beta) (Type I protein geranyl-geranyltransferase subunit beta)
Protein function Catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to a cysteine at the fourth position from the C-terminus of proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X. Known substrates include RAC1, R
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00432 Prenyltrans 142 186 Prenyltransferase and squalene oxidase repeat Repeat
PF00432 Prenyltrans 191 234 Prenyltransferase and squalene oxidase repeat Repeat
PF00432 Prenyltrans 240 284 Prenyltransferase and squalene oxidase repeat Repeat
PF00432 Prenyltrans 289 333 Prenyltransferase and squalene oxidase repeat Repeat
Sequence
MAATEDERLAGSGEGERLDFLRDRHVRFFQRCLQVLPERYSSLETSRLTIAFFALSGLDM
LDSLDVVNKDDIIEWIYSLQVLPTEDRSNLNRCGFRGSSYLGIPFNPSKAPGTAHPYDSG
HIAMTYTGLSCLVILGDDLSRVNKEACLAGLRALQLEDGSFCAVPEGSENDMRFVYCASC
ICYMLN
NWSGMDMKKAITYIRRSMSYDNGLAQGAGLESHGGSTFCGIASLCLMGKLEEVF
SEKELNRIKRWCIMRQQNGYHGRPNKPVDTCYSFWVGATLKLLK
IFQYTNFEKNRNYILS
TQDRLVGGFAKWPDSHPDALHAYFGICGLSLME
ESGICKVHPALNVSTRTSERLLDLHQS
WKTKDSKQCSENVHIST
Sequence length 377
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Non Small Cell Lung Associate 25956913
Gout Associate 32630231
Inflammation Associate 32630231
Lung Neoplasms Inhibit 20113484
Multiple Myeloma Inhibit 16156861
Neoplasms Inhibit 31108950