Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5228
Gene name Gene Name - the full gene name approved by the HGNC.
Placental growth factor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PGF
Synonyms (NCBI Gene) Gene synonyms aliases
D12S1900, PGFL, PIGF, PLGF, PlGF-2, SHGC-10760
Chromosome Chromosome number
14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q24.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a growth factor found in placenta which is homologous to vascular endothelial growth factor. Alternatively spliced transcripts encoding different isoforms have been found for this gene.[provided by RefSeq, Jun 2011]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1227362 hsa-miR-214 CLIP-seq
MIRT1227363 hsa-miR-296-5p CLIP-seq
MIRT1227364 hsa-miR-3185 CLIP-seq
MIRT1227365 hsa-miR-3619-5p CLIP-seq
MIRT1227366 hsa-miR-3652 CLIP-seq
Transcription factors
Transcription factor Regulation Reference
GCM1 Activation 18160678
MTF1 Unknown 19956853
STAT3 Repression 23042533
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis IEA
GO:0001666 Process Response to hypoxia IBA
GO:0002040 Process Sprouting angiogenesis IBA
GO:0005172 Function Vascular endothelial growth factor receptor binding IBA
GO:0005515 Function Protein binding IPI 14684734, 20660291
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601121 8893 ENSG00000119630
Protein
UniProt ID P49763
Protein name Placenta growth factor (PlGF)
Protein function Growth factor active in angiogenesis and endothelial cell growth, stimulating their proliferation and migration. It binds to the receptor FLT1/VEGFR-1. Isoform PlGF-2 binds NRP1/neuropilin-1 and NRP2/neuropilin-2 in a heparin-dependent manner. A
PDB 1FZV , 1RV6
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00341 PDGF 52 130 PDGF/VEGF domain Domain
Tissue specificity TISSUE SPECIFICITY: While the three isoforms are present in most placental tissues, PlGF-2 is specific to early (8 week) placenta and only PlGF-1 is found in the colon and mammary carcinomas.
Sequence
MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVD
VVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVEL
TFSQHVRCEC
RHSPGRQSPDMPGDFRADAPSFLPPRRSLPMLFRMEWGCALTGSQSAVWP
SSPVPEEIPRMHPGRNGKKQQRKPLREKMKPERCGDAVPRR
Sequence length 221
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Focal adhesion
Pathways in cancer
  VEGF ligand-receptor interactions
VEGF binds to VEGFR leading to receptor dimerization
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Coronary artery disease Coronary artery disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abortion Habitual Associate 31395028
Abortion Spontaneous Associate 37968664
Acute Coronary Syndrome Associate 37787982
Acute Kidney Injury Associate 36385130
Adenocarcinoma Associate 35800186
Adenocarcinoma of Lung Associate 23874428
Alzheimer Disease Associate 36680854, 36905877
Anemia Associate 18411415
Anemia Sickle Cell Associate 12689930, 12714517, 18411415, 18945963, 21175428, 25403488
Angina Pectoris Associate 37787982