Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	5228
Gene name	Placental growth factor
Gene symbol	PGF
Synonyms (NCBI Gene)	D12S1900PGFLPIGFPLGFPlGF-2SHGC-10760
Chromosome	14
Chromosome location	14q24.3
Summary	This gene encodes a growth factor found in placenta which is homologous to vascular endothelial growth factor. Alternatively spliced transcripts encoding different isoforms have been found for this gene.[provided by RefSeq, Jun 2011]

Show/Hide all (77)

miRTarBase ID	miRNA	Experiments
MIRT1227362	hsa-miR-214	CLIP-seq
MIRT1227363	hsa-miR-296-5p	CLIP-seq
MIRT1227364	hsa-miR-3185	CLIP-seq
MIRT1227365	hsa-miR-3619-5p	CLIP-seq
MIRT1227366	hsa-miR-3652	CLIP-seq
MIRT1227367	hsa-miR-3918	CLIP-seq
MIRT1227368	hsa-miR-4271	CLIP-seq
MIRT1227369	hsa-miR-4313	CLIP-seq
MIRT1227370	hsa-miR-4420	CLIP-seq
MIRT1227371	hsa-miR-4430	CLIP-seq
MIRT1227372	hsa-miR-4433	CLIP-seq
MIRT1227373	hsa-miR-4505	CLIP-seq
MIRT1227374	hsa-miR-4530	CLIP-seq
MIRT1227375	hsa-miR-4690-5p	CLIP-seq
MIRT1227376	hsa-miR-4709-3p	CLIP-seq
MIRT1227377	hsa-miR-4716-3p	CLIP-seq
MIRT1227378	hsa-miR-4722-5p	CLIP-seq
MIRT1227379	hsa-miR-4725-3p	CLIP-seq
MIRT1227380	hsa-miR-4773	CLIP-seq
MIRT1227381	hsa-miR-4795-5p	CLIP-seq
MIRT1227382	hsa-miR-625	CLIP-seq
MIRT1227383	hsa-miR-634	CLIP-seq
MIRT1227384	hsa-miR-761	CLIP-seq
MIRT1556803	hsa-miR-4768-5p	CLIP-seq
MIRT2066587	hsa-miR-1205	CLIP-seq
MIRT2066588	hsa-miR-1245b-3p	CLIP-seq
MIRT2066589	hsa-miR-1291	CLIP-seq
MIRT2066590	hsa-miR-1909	CLIP-seq
MIRT1227362	hsa-miR-214	CLIP-seq
MIRT2066591	hsa-miR-3155	CLIP-seq
MIRT2066592	hsa-miR-3155b	CLIP-seq
MIRT2066593	hsa-miR-3173-5p	CLIP-seq
MIRT2066594	hsa-miR-328	CLIP-seq
MIRT2066595	hsa-miR-331-3p	CLIP-seq
MIRT2066596	hsa-miR-34a	CLIP-seq
MIRT2066597	hsa-miR-34c-5p	CLIP-seq
MIRT1227365	hsa-miR-3619-5p	CLIP-seq
MIRT2066598	hsa-miR-4261	CLIP-seq
MIRT2066599	hsa-miR-4268	CLIP-seq
MIRT2066600	hsa-miR-4291	CLIP-seq
MIRT2066601	hsa-miR-4299	CLIP-seq
MIRT2066602	hsa-miR-4438	CLIP-seq
MIRT2066603	hsa-miR-4452	CLIP-seq
MIRT2066604	hsa-miR-449a	CLIP-seq
MIRT2066605	hsa-miR-449b	CLIP-seq
MIRT2066606	hsa-miR-4645-5p	CLIP-seq
MIRT2066607	hsa-miR-4673	CLIP-seq
MIRT2066608	hsa-miR-4680-3p	CLIP-seq
MIRT2066609	hsa-miR-484	CLIP-seq
MIRT1227384	hsa-miR-761	CLIP-seq
MIRT2066610	hsa-miR-922	CLIP-seq
MIRT1227362	hsa-miR-214	CLIP-seq
MIRT1227365	hsa-miR-3619-5p	CLIP-seq
MIRT2066598	hsa-miR-4261	CLIP-seq
MIRT2066600	hsa-miR-4291	CLIP-seq
MIRT2294141	hsa-miR-4715-5p	CLIP-seq
MIRT1227384	hsa-miR-761	CLIP-seq
MIRT2066610	hsa-miR-922	CLIP-seq
MIRT2687725	hsa-miR-1207-3p	CLIP-seq
MIRT2687726	hsa-miR-3064-5p	CLIP-seq
MIRT2066591	hsa-miR-3155	CLIP-seq
MIRT2066592	hsa-miR-3155b	CLIP-seq
MIRT2687727	hsa-miR-3160-3p	CLIP-seq
MIRT2066595	hsa-miR-331-3p	CLIP-seq
MIRT2687728	hsa-miR-4252	CLIP-seq
MIRT2066599	hsa-miR-4268	CLIP-seq
MIRT2687729	hsa-miR-4286	CLIP-seq
MIRT2687730	hsa-miR-4297	CLIP-seq
MIRT2066601	hsa-miR-4299	CLIP-seq
MIRT2066602	hsa-miR-4438	CLIP-seq
MIRT2687731	hsa-miR-4487	CLIP-seq
MIRT2066606	hsa-miR-4645-5p	CLIP-seq
MIRT2687732	hsa-miR-4663	CLIP-seq
MIRT2066607	hsa-miR-4673	CLIP-seq
MIRT2066609	hsa-miR-484	CLIP-seq
MIRT2687733	hsa-miR-558	CLIP-seq
MIRT2687734	hsa-miR-892b	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
GCM1	Activation	18160678
MTF1	Unknown	19956853
STAT3	Repression	23042533

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001666	Process	Response to hypoxia	IBA
GO:0002040	Process	Sprouting angiogenesis	IBA
GO:0005172	Function	Vascular endothelial growth factor receptor binding	IBA
GO:0005515	Function	Protein binding	IPI	14684734, 20660291
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0007165	Process	Signal transduction	TAS	9467961
GO:0007267	Process	Cell-cell signaling	TAS	9467961
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IEA
GO:0008083	Function	Growth factor activity	IMP	21215706
GO:0008083	Function	Growth factor activity	TAS	9467961
GO:0008201	Function	Heparin binding	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	21215706
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	9467961
GO:0016020	Component	Membrane	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0038084	Process	Vascular endothelial growth factor signaling pathway	IBA
GO:0042056	Function	Chemoattractant activity	IBA
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IBA
GO:0048018	Function	Receptor ligand activity	IEA
GO:0050918	Process	Positive chemotaxis	IEA
GO:0050930	Process	Induction of positive chemotaxis	IBA
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0060754	Process	Positive regulation of mast cell chemotaxis	IBA

MIM	HGNC	e!Ensembl
601121	8893	ENSG00000119630

P49763

Protein name

Placenta growth factor (PlGF)

Protein function

Growth factor active in angiogenesis and endothelial cell growth, stimulating their proliferation and migration. It binds to the receptor FLT1/VEGFR-1. Isoform PlGF-2 binds NRP1/neuropilin-1 and NRP2/neuropilin-2 in a heparin-dependent manner. A

PDB

1FZV , 1RV6

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00341	PDGF	52 → 130	PDGF/VEGF domain	Domain

Tissue specificity

TISSUE SPECIFICITY: While the three isoforms are present in most placental tissues, PlGF-2 is specific to early (8 week) placenta and only PlGF-1 is found in the colon and mammary carcinomas.

Sequence

MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVD
VVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVEL
TFSQHVRCECRHSPGRQSPDMPGDFRADAPSFLPPRRSLPMLFRMEWGCALTGSQSAVWP
SSPVPEEIPRMHPGRNGKKQQRKPLREKMKPERCGDAVPRR

Sequence length

221

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Ras signaling pathway Rap1 signaling pathway PI3K-Akt signaling pathway Focal adhesion Pathways in cancer		VEGF ligand-receptor interactions VEGF binds to VEGFR leading to receptor dimerization

PGF (placental growth factor)