Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5166
Gene name	Pyruvate dehydrogenase kinase 4
Gene symbol	PDK4
Synonyms (NCBI Gene)	-
Chromosome	7
Chromosome location	7q21.3
Summary	This gene is a member of the PDK/BCKDK protein kinase family and encodes a mitochondrial protein with a histidine kinase domain. This protein is located in the matrix of the mitrochondria and inhibits the pyruvate dehydrogenase complex by phosphorylating

214

Show/Hide all (214)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018910	hsa-miR-335-5p	Microarray	18185580
MIRT027229	hsa-miR-103a-3p	Sequencing	20371350
MIRT030098	hsa-miR-26b-5p	Microarray	19088304
MIRT032003	hsa-miR-16-5p	Sequencing	20371350
MIRT734505	hsa-miR-152-3p	ELISAFlow cytometryImmunoprecipitaion (IP)Luciferase reporter assayqRT-PCRWestern blotting	34165388
MIRT1222070	hsa-miR-421	CLIP-seq
MIRT1222071	hsa-miR-4272	CLIP-seq
MIRT2064337	hsa-miR-329	CLIP-seq
MIRT2064338	hsa-miR-362-3p	CLIP-seq
MIRT2064339	hsa-miR-3667-3p	CLIP-seq
MIRT2064340	hsa-miR-3941	CLIP-seq
MIRT2064341	hsa-miR-466	CLIP-seq
MIRT2064342	hsa-miR-4672	CLIP-seq
MIRT2064343	hsa-miR-4768-5p	CLIP-seq
MIRT2064344	hsa-miR-579	CLIP-seq
MIRT2064345	hsa-miR-603	CLIP-seq
MIRT2292654	hsa-miR-338-3p	CLIP-seq
MIRT2292655	hsa-miR-4310	CLIP-seq
MIRT2292656	hsa-miR-4659a-3p	CLIP-seq
MIRT2292657	hsa-miR-4659b-3p	CLIP-seq
MIRT2064343	hsa-miR-4768-5p	CLIP-seq
MIRT2439325	hsa-miR-1208	CLIP-seq
MIRT2439326	hsa-miR-1224-3p	CLIP-seq
MIRT2439327	hsa-miR-1260	CLIP-seq
MIRT2439328	hsa-miR-1260b	CLIP-seq
MIRT2439329	hsa-miR-1280	CLIP-seq
MIRT2439330	hsa-miR-136	CLIP-seq
MIRT2439331	hsa-miR-141	CLIP-seq
MIRT2439332	hsa-miR-200a	CLIP-seq
MIRT2439333	hsa-miR-216b	CLIP-seq
MIRT2439334	hsa-miR-3117-3p	CLIP-seq
MIRT2439335	hsa-miR-3169	CLIP-seq
MIRT2439336	hsa-miR-3173-3p	CLIP-seq
MIRT2439337	hsa-miR-330-3p	CLIP-seq
MIRT2439338	hsa-miR-340	CLIP-seq
MIRT2439339	hsa-miR-3622b-5p	CLIP-seq
MIRT2439340	hsa-miR-3646	CLIP-seq
MIRT2439341	hsa-miR-3653	CLIP-seq
MIRT2439342	hsa-miR-3658	CLIP-seq
MIRT2439343	hsa-miR-371-5p	CLIP-seq
MIRT2439344	hsa-miR-371b-5p	CLIP-seq
MIRT2439345	hsa-miR-3920	CLIP-seq
MIRT2439346	hsa-miR-3973	CLIP-seq
MIRT2439347	hsa-miR-4422	CLIP-seq
MIRT2439348	hsa-miR-4428	CLIP-seq
MIRT2439349	hsa-miR-4462	CLIP-seq
MIRT2439350	hsa-miR-4477b	CLIP-seq
MIRT2439351	hsa-miR-4704-5p	CLIP-seq
MIRT2439352	hsa-miR-4720-5p	CLIP-seq
MIRT2439353	hsa-miR-4735-5p	CLIP-seq
MIRT2439354	hsa-miR-4759	CLIP-seq
MIRT2439355	hsa-miR-4762-3p	CLIP-seq
MIRT2439356	hsa-miR-4795-3p	CLIP-seq
MIRT2439357	hsa-miR-4799-3p	CLIP-seq
MIRT2439358	hsa-miR-548a-5p	CLIP-seq
MIRT2439359	hsa-miR-548ab	CLIP-seq
MIRT2439360	hsa-miR-548ak	CLIP-seq
MIRT2439361	hsa-miR-548b-5p	CLIP-seq
MIRT2439362	hsa-miR-548c-5p	CLIP-seq
MIRT2439363	hsa-miR-548d-5p	CLIP-seq
MIRT2439364	hsa-miR-548h	CLIP-seq
MIRT2439365	hsa-miR-548i	CLIP-seq
MIRT2439366	hsa-miR-548j	CLIP-seq
MIRT2439367	hsa-miR-548w	CLIP-seq
MIRT2439368	hsa-miR-548y	CLIP-seq
MIRT2439369	hsa-miR-555	CLIP-seq
MIRT2439370	hsa-miR-559	CLIP-seq
MIRT2439371	hsa-miR-580	CLIP-seq
MIRT2439372	hsa-miR-602	CLIP-seq
MIRT2439373	hsa-miR-626	CLIP-seq
MIRT2439374	hsa-miR-643	CLIP-seq
MIRT2439375	hsa-miR-668	CLIP-seq
MIRT2439331	hsa-miR-141	CLIP-seq
MIRT2439332	hsa-miR-200a	CLIP-seq
MIRT2439351	hsa-miR-4704-5p	CLIP-seq
MIRT2590642	hsa-miR-103a	CLIP-seq
MIRT2590643	hsa-miR-106a	CLIP-seq
MIRT2590644	hsa-miR-106b	CLIP-seq
MIRT2590645	hsa-miR-107	CLIP-seq
MIRT2439325	hsa-miR-1208	CLIP-seq
MIRT2439326	hsa-miR-1224-3p	CLIP-seq
MIRT2439327	hsa-miR-1260	CLIP-seq
MIRT2439328	hsa-miR-1260b	CLIP-seq
MIRT2590646	hsa-miR-1271	CLIP-seq
MIRT2439329	hsa-miR-1280	CLIP-seq
MIRT2590647	hsa-miR-129-5p	CLIP-seq
MIRT2439331	hsa-miR-141	CLIP-seq
MIRT2590648	hsa-miR-15a	CLIP-seq
MIRT2590649	hsa-miR-15b	CLIP-seq
MIRT2590650	hsa-miR-16	CLIP-seq
MIRT2590651	hsa-miR-17	CLIP-seq
MIRT2590652	hsa-miR-182	CLIP-seq
MIRT2590653	hsa-miR-195	CLIP-seq
MIRT2439332	hsa-miR-200a	CLIP-seq
MIRT2590654	hsa-miR-20a	CLIP-seq
MIRT2590655	hsa-miR-20b	CLIP-seq
MIRT2590656	hsa-miR-28-5p	CLIP-seq
MIRT2439334	hsa-miR-3117-3p	CLIP-seq
MIRT2590657	hsa-miR-3139	CLIP-seq
MIRT2590658	hsa-miR-3145-3p	CLIP-seq
MIRT2439335	hsa-miR-3169	CLIP-seq
MIRT2439337	hsa-miR-330-3p	CLIP-seq
MIRT2439338	hsa-miR-340	CLIP-seq
MIRT2590659	hsa-miR-3591-5p	CLIP-seq
MIRT2590660	hsa-miR-3609	CLIP-seq
MIRT2590661	hsa-miR-361-5p	CLIP-seq
MIRT2439341	hsa-miR-3653	CLIP-seq
MIRT2439342	hsa-miR-3658	CLIP-seq
MIRT2590662	hsa-miR-3682-3p	CLIP-seq
MIRT2439343	hsa-miR-371-5p	CLIP-seq
MIRT2439344	hsa-miR-371b-5p	CLIP-seq
MIRT2439346	hsa-miR-3973	CLIP-seq
MIRT2590663	hsa-miR-424	CLIP-seq
MIRT2590664	hsa-miR-4257	CLIP-seq
MIRT2439349	hsa-miR-4462	CLIP-seq
MIRT2590665	hsa-miR-4502	CLIP-seq
MIRT2439351	hsa-miR-4704-5p	CLIP-seq
MIRT2439353	hsa-miR-4735-5p	CLIP-seq
MIRT2439354	hsa-miR-4759	CLIP-seq
MIRT2439355	hsa-miR-4762-3p	CLIP-seq
MIRT2439356	hsa-miR-4795-3p	CLIP-seq
MIRT2590666	hsa-miR-4796-3p	CLIP-seq
MIRT2590667	hsa-miR-497	CLIP-seq
MIRT2590668	hsa-miR-519d	CLIP-seq
MIRT2590669	hsa-miR-548a-3p	CLIP-seq
MIRT2439358	hsa-miR-548a-5p	CLIP-seq
MIRT2439359	hsa-miR-548ab	CLIP-seq
MIRT2590670	hsa-miR-548ac	CLIP-seq
MIRT2590671	hsa-miR-548ae	CLIP-seq
MIRT2590672	hsa-miR-548ah	CLIP-seq
MIRT2590673	hsa-miR-548aj	CLIP-seq
MIRT2439360	hsa-miR-548ak	CLIP-seq
MIRT2590674	hsa-miR-548am	CLIP-seq
MIRT2439361	hsa-miR-548b-5p	CLIP-seq
MIRT2439362	hsa-miR-548c-5p	CLIP-seq
MIRT2590675	hsa-miR-548d-3p	CLIP-seq
MIRT2439363	hsa-miR-548d-5p	CLIP-seq
MIRT2590676	hsa-miR-548e	CLIP-seq
MIRT2590677	hsa-miR-548f	CLIP-seq
MIRT2439364	hsa-miR-548h	CLIP-seq
MIRT2439365	hsa-miR-548i	CLIP-seq
MIRT2439366	hsa-miR-548j	CLIP-seq
MIRT2439367	hsa-miR-548w	CLIP-seq
MIRT2590678	hsa-miR-548x	CLIP-seq
MIRT2439368	hsa-miR-548y	CLIP-seq
MIRT2590679	hsa-miR-548z	CLIP-seq
MIRT2439369	hsa-miR-555	CLIP-seq
MIRT2439370	hsa-miR-559	CLIP-seq
MIRT2590680	hsa-miR-595	CLIP-seq
MIRT2439372	hsa-miR-602	CLIP-seq
MIRT2590681	hsa-miR-648	CLIP-seq
MIRT2439375	hsa-miR-668	CLIP-seq
MIRT2590682	hsa-miR-708	CLIP-seq
MIRT2590683	hsa-miR-93	CLIP-seq
MIRT2590684	hsa-miR-96	CLIP-seq
MIRT2590642	hsa-miR-103a	CLIP-seq
MIRT2590643	hsa-miR-106a	CLIP-seq
MIRT2590644	hsa-miR-106b	CLIP-seq
MIRT2590645	hsa-miR-107	CLIP-seq
MIRT2439325	hsa-miR-1208	CLIP-seq
MIRT2439326	hsa-miR-1224-3p	CLIP-seq
MIRT2439327	hsa-miR-1260	CLIP-seq
MIRT2439328	hsa-miR-1260b	CLIP-seq
MIRT2439329	hsa-miR-1280	CLIP-seq
MIRT2590648	hsa-miR-15a	CLIP-seq
MIRT2590649	hsa-miR-15b	CLIP-seq
MIRT2590650	hsa-miR-16	CLIP-seq
MIRT2590651	hsa-miR-17	CLIP-seq
MIRT2590653	hsa-miR-195	CLIP-seq
MIRT2590654	hsa-miR-20a	CLIP-seq
MIRT2590655	hsa-miR-20b	CLIP-seq
MIRT2590656	hsa-miR-28-5p	CLIP-seq
MIRT2439334	hsa-miR-3117-3p	CLIP-seq
MIRT2590657	hsa-miR-3139	CLIP-seq
MIRT2439335	hsa-miR-3169	CLIP-seq
MIRT2439337	hsa-miR-330-3p	CLIP-seq
MIRT2439338	hsa-miR-340	CLIP-seq
MIRT2590659	hsa-miR-3591-5p	CLIP-seq
MIRT2590660	hsa-miR-3609	CLIP-seq
MIRT2590661	hsa-miR-361-5p	CLIP-seq
MIRT2439341	hsa-miR-3653	CLIP-seq
MIRT2439342	hsa-miR-3658	CLIP-seq
MIRT2590662	hsa-miR-3682-3p	CLIP-seq
MIRT2439343	hsa-miR-371-5p	CLIP-seq
MIRT2439344	hsa-miR-371b-5p	CLIP-seq
MIRT2590663	hsa-miR-424	CLIP-seq
MIRT2590664	hsa-miR-4257	CLIP-seq
MIRT2439349	hsa-miR-4462	CLIP-seq
MIRT2590665	hsa-miR-4502	CLIP-seq
MIRT2439353	hsa-miR-4735-5p	CLIP-seq
MIRT2439354	hsa-miR-4759	CLIP-seq
MIRT2439355	hsa-miR-4762-3p	CLIP-seq
MIRT2439356	hsa-miR-4795-3p	CLIP-seq
MIRT2590666	hsa-miR-4796-3p	CLIP-seq
MIRT2590667	hsa-miR-497	CLIP-seq
MIRT2590668	hsa-miR-519d	CLIP-seq
MIRT2590669	hsa-miR-548a-3p	CLIP-seq
MIRT2590670	hsa-miR-548ac	CLIP-seq
MIRT2590671	hsa-miR-548ae	CLIP-seq
MIRT2590672	hsa-miR-548ah	CLIP-seq
MIRT2590673	hsa-miR-548aj	CLIP-seq
MIRT2590674	hsa-miR-548am	CLIP-seq
MIRT2590675	hsa-miR-548d-3p	CLIP-seq
MIRT2590676	hsa-miR-548e	CLIP-seq
MIRT2590677	hsa-miR-548f	CLIP-seq
MIRT2590678	hsa-miR-548x	CLIP-seq
MIRT2590679	hsa-miR-548z	CLIP-seq
MIRT2439369	hsa-miR-555	CLIP-seq
MIRT2590680	hsa-miR-595	CLIP-seq
MIRT2439372	hsa-miR-602	CLIP-seq
MIRT2590681	hsa-miR-648	CLIP-seq
MIRT2439375	hsa-miR-668	CLIP-seq
MIRT2590682	hsa-miR-708	CLIP-seq
MIRT2590683	hsa-miR-93	CLIP-seq

Show/Hide all (5)

Transcription factor	Regulation	Reference
E2F1	Repression	21625432
NFKB1	Repression	21625432
PPARA	Activation	15955060
PPARD	Activation	15955060
RELA	Repression	21625432

Show/Hide all (46)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IDA	18658136
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	TAS	8798399
GO:0004740	Function	Pyruvate dehydrogenase (acetyl-transferring) kinase activity	IBA
GO:0004740	Function	Pyruvate dehydrogenase (acetyl-transferring) kinase activity	IEA
GO:0004740	Function	Pyruvate dehydrogenase (acetyl-transferring) kinase activity	ISS
GO:0004740	Function	Pyruvate dehydrogenase (acetyl-transferring) kinase activity	TAS	8798399
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005524	Function	ATP binding	IDA	18658136
GO:0005524	Function	ATP binding	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	TAS	8798399
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0006885	Process	Regulation of pH	IEA
GO:0006885	Process	Regulation of pH	ISS
GO:0008286	Process	Insulin receptor signaling pathway	IBA
GO:0008286	Process	Insulin receptor signaling pathway	IEA
GO:0008286	Process	Insulin receptor signaling pathway	IMP	21852536
GO:0009267	Process	Cellular response to starvation	IDA	14966024
GO:0010510	Process	Regulation of pyruvate decarboxylation to acetyl-CoA	IBA
GO:0010510	Process	Regulation of pyruvate decarboxylation to acetyl-CoA	IEA
GO:0010510	Process	Regulation of pyruvate decarboxylation to acetyl-CoA	IMP	21852536
GO:0010565	Process	Regulation of ketone metabolic process	IEA
GO:0010565	Process	Regulation of ketone metabolic process	ISS
GO:0010906	Process	Regulation of glucose metabolic process	IBA
GO:0010906	Process	Regulation of glucose metabolic process	IEA
GO:0010906	Process	Regulation of glucose metabolic process	IMP	21852536
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0033554	Process	Cellular response to stress	IEA
GO:0042304	Process	Regulation of fatty acid biosynthetic process	IEA
GO:0042304	Process	Regulation of fatty acid biosynthetic process	IMP	21852536
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042593	Process	Glucose homeostasis	ISS
GO:0042594	Process	Response to starvation	IEA
GO:0042594	Process	Response to starvation	ISS
GO:0045124	Process	Regulation of bone resorption	IEA
GO:0046320	Process	Regulation of fatty acid oxidation	IEA
GO:0046320	Process	Regulation of fatty acid oxidation	ISS
GO:0071398	Process	Cellular response to fatty acid	IMP	20715114
GO:0072593	Process	Reactive oxygen species metabolic process	IMP	21852536
GO:2000811	Process	Negative regulation of anoikis	IMP	21852536

MIM	HGNC	e!Ensembl
602527	8812	ENSG00000004799

Q16654

Protein name

[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial (EC 2.7.11.2) (Pyruvate dehydrogenase kinase isoform 4)

Protein function

Kinase that plays a key role in regulation of glucose and fatty acid metabolism and homeostasis via phosphorylation of the pyruvate dehydrogenase subunits PDHA1 and PDHA2. This inhibits pyruvate dehydrogenase activity, and thereby regulates meta

PDB

2E0A , 2ZDX , 2ZDY , 2ZKJ , 3D2R , 7EAT , 7EBB , 7EBG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10436	BCDHK_Adom3	34 → 195	Mitochondrial branched-chain alpha-ketoacid dehydrogenase kinase	Family
PF02518	HATPase_c	243 → 368	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous; highest levels of expression in heart and skeletal muscle. {ECO:0000269|PubMed:14966024, ECO:0000269|PubMed:21816445}.

Sequence

MKAARFVLRSAGSLNGAGLVPREVEHFSRYSPSPLSMKQLLDFGSENACERTSFAFLRQE
LPVRLANILKEIDILPTQLVNTSSVQLVKSWYIQSLMDLVEFHEKSPDDQKALSDFVDTL
IKVRNRHHNVVPTMAQGIIEYKDACTVDPVTNQNLQYFLDRFYMNRISTRMLMNQHILIF
SDSQTGNPSHIGSIDPNCDVVAVVQDAFECSRMLCDQYYLSSPELKLTQVNGKFPDQPIH
IVYVPSHLHHMLFELFKNAMRATVEHQENQPSLTPIEVIVVLGKEDLTIKISDRGGGVPL
RIIDRLFSYTYSTAPTPVMDNSRNAPLAGFGYGLPISRLYAKYFQGDLNLYSLSGYGTDA
IIYLKALSSESIEKLPVFNKSAFKHYQMSSEADDWCIPSREPKNLAKEVAM

Sequence length

411

Interactions

View interactions

	KEGG		Reactome
	Diabetic cardiomyopathy		Regulation of pyruvate dehydrogenase (PDH) complex Signaling by Retinoic Acid

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (49)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Arthritis Rheumatoid	Stimulate	29129636	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ascites	Associate	32390009	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Associate	27332823	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	33763657, 37893423, 39380996	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	26506419, 30837223, 34557456, 37398672, 37787988	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	33564363, 37689589	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Associate	28500252, 32127618	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Associate	36582228	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	28692044, 35894141, 37340443	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	32127618	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Associate	33739370	★★★★★ ★☆☆☆☆ Found in Text Mining only
Critical Illness	Associate	21669975	★★★★★ ★☆☆☆☆ Found in Text Mining only
Death Sudden Cardiac	Inhibit	24642708	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Stimulate	37385224	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Inhibit	37863991	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Associate	18658136	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Associate	36092962, 37385224, 40312440	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Associate	29301256	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Associate	34981661	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Associate	24642708	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Associate	28500252	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Associate	28500252	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Stimulate	23050013, 25630799	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Stimulate	35130915	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	36582228	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemia	Associate	38049739	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Associate	37147361	★★★★★ ★☆☆☆☆ Found in Text Mining only
Knee Injuries	Associate	31496670	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	26787841	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscle Neoplasms	Associate	25531450	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Associate	40620566	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasm Metastasis	Associate	32390009	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	24376596, 25715123, 30837223, 32390009, 34370552, 35894141, 40312902	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	33477333	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Associate	25630799	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Associate	21190973, 22253914, 23583180	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	32390009, 33926489, 37098796	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pneumonia Lipid	Associate	35269515	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Associate	37863991	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	40312902	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Associate	33416099	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Associate	27456128	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Associate	33833937	★★★★★ ★☆☆☆☆ Found in Text Mining only
Reperfusion Injury	Inhibit	37240246	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	37452322	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	34840985, 36044785	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Associate	32626985	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Associate	35543351	★★★★★ ★☆☆☆☆ Found in Text Mining only
Weight Loss	Associate	23583180, 31496670	★★★★★ ★☆☆☆☆ Found in Text Mining only

PDK4 (pyruvate dehydrogenase kinase 4)