Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5157
Gene name Gene Name - the full gene name approved by the HGNC.	Platelet derived growth factor receptor like
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PDGFRL
Synonyms (NCBI Gene) Gene synonyms aliases	PDGRL, PRLTS
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8p22
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein with significant sequence similarity to the ligand binding domain of platelet-derived growth factor receptor beta. Mutations in this gene, or deletion of a chromosomal segment containing this gene, are associated with sporadic

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs137853148	C>T	Pathogenic	Missense variant, coding sequence variant

Show/Hide all(35)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029428	hsa-miR-26b-5p	Microarray	19088304
MIRT050268	hsa-miR-25-3p	CLASH	23622248
MIRT1221275	hsa-miR-1257	CLIP-seq
MIRT1221276	hsa-miR-141	CLIP-seq
MIRT1221277	hsa-miR-200a	CLIP-seq
MIRT1221278	hsa-miR-3182	CLIP-seq
MIRT1221279	hsa-miR-3668	CLIP-seq
MIRT1221280	hsa-miR-3914	CLIP-seq
MIRT1221281	hsa-miR-4677-3p	CLIP-seq
MIRT1221282	hsa-miR-4679	CLIP-seq
MIRT1221283	hsa-miR-4698	CLIP-seq
MIRT2063865	hsa-miR-1231	CLIP-seq
MIRT2063866	hsa-miR-1243	CLIP-seq
MIRT2063867	hsa-miR-1255a	CLIP-seq
MIRT2063868	hsa-miR-1255b	CLIP-seq
MIRT2063869	hsa-miR-1273e	CLIP-seq
MIRT2063870	hsa-miR-139-3p	CLIP-seq
MIRT2063871	hsa-miR-151-3p	CLIP-seq
MIRT2063872	hsa-miR-3170	CLIP-seq
MIRT2063873	hsa-miR-342-5p	CLIP-seq
MIRT2063874	hsa-miR-3907	CLIP-seq
MIRT2063875	hsa-miR-3913-3p	CLIP-seq
MIRT2063876	hsa-miR-4455	CLIP-seq
MIRT2063877	hsa-miR-4463	CLIP-seq
MIRT2063878	hsa-miR-4499	CLIP-seq
MIRT2063879	hsa-miR-4651	CLIP-seq
MIRT2063880	hsa-miR-4664-5p	CLIP-seq
MIRT2063881	hsa-miR-4731-5p	CLIP-seq
MIRT2063882	hsa-miR-4764-5p	CLIP-seq
MIRT2063883	hsa-miR-4798-3p	CLIP-seq
MIRT2063884	hsa-miR-489	CLIP-seq
MIRT2063885	hsa-miR-608	CLIP-seq
MIRT2063886	hsa-miR-617	CLIP-seq
MIRT2063887	hsa-miR-636	CLIP-seq
MIRT2063888	hsa-miR-654-3p	CLIP-seq

Show/Hide all(7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004992	Function	Platelet activating factor receptor activity	TAS	7898930
GO:0005019	Function	Platelet-derived growth factor beta-receptor activity	TAS	7898930
GO:0005575	Component	Cellular_component	ND
GO:0005576	Component	Extracellular region	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0008150	Process	Biological_process	ND
GO:0035791	Process	Platelet-derived growth factor receptor-beta signaling pathway	IEA

MIM	HGNC	e!Ensembl
604584	8805	ENSG00000104213

Protein

UniProt ID

Q15198

Protein name

Platelet-derived growth factor receptor-like protein (PDGFR-like protein) (PDGF receptor beta-like tumor suppressor)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13927	Ig_3	271 → 361		Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in colon, lung and liver. {ECO:0000269|PubMed:7898930}.

Sequence

MKVWLLLGLLLVHEALEDVTGQHLPKNKRPKEPGENRIKPTNKKVKPKIPKMKDRDSANS
APKTQSIMMQVLDKGRFQKPAATLSLLAGQTVELRCKGSRIGWSYPAYLDTFKDSRLSVK
QNERYGQLTLVNSTSADTGEFSCWVQLCSGYICRKDEAKTGSTYIFFTEKGELFVPSPSY
FDVVYLNPDRQAVVPCRVTVLSAKVTLHREFPAKEIPANGTDIVYDMKRGFVYLQPHSEH
QGVVYCRAEAGGRSQISVKYQLLYVAVPSGPPSTTILASSNKVKSGDDISVLCTVLGEPD
VEVEFTWIFPGQKDERPVTIQDTWRLIHRGLGHTTRISQSVITVEDFETIDAGYYICTAQ
NLQGQTTVATTVEFS

Sequence length

375

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Colorectal cancer	Colorectal Carcinoma, Adenocarcinoma of large intestine	rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800 View all (467 more)	7898930

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenoma	Associate	28501704
Carcinoma Basal Cell	Associate	17273163
Colorectal Neoplasms	Inhibit	20333786
Endometriosis	Associate	36524127
Intellectual Disability	Associate	21513506
Neoplasms	Inhibit	16270321, 18366601
Neoplasms	Associate	20333786, 9197531
Ovarian Neoplasms	Associate	16270321
Prostatic Neoplasms	Associate	9197531

PDGFRL (platelet derived growth factor receptor like)