Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
51535
Gene name Gene Name - the full gene name approved by the HGNC.
Periphilin 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PPHLN1
Synonyms (NCBI Gene) Gene synonyms aliases
CR, HSPC206, HSPC232
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q12
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is one of the several proteins that become sequentially incorporated into the cornified cell envelope during the terminal differentiation of keratinocyte at the outer layers of epidermis. This protein interacts with peripl
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT439924 hsa-miR-409-3p HITS-CLIP 24374217
MIRT439924 hsa-miR-409-3p HITS-CLIP 24374217
MIRT1252597 hsa-miR-151-3p CLIP-seq
MIRT1252598 hsa-miR-3936 CLIP-seq
MIRT1252599 hsa-miR-4463 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IBA
GO:0005654 Component Nucleoplasm IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608150 19369 ENSG00000134283
Protein
UniProt ID Q8NEY8
Protein name Periphilin-1 (CDC7 expression repressor) (CR) (Gastric cancer antigen Ga50)
Protein function Component of the HUSH complex, a multiprotein complex that mediates epigenetic repression. The HUSH complex is recruited to genomic loci rich in H3K9me3 and is probably required to maintain transcriptional silencing by promoting recruitment of S
PDB 6SWG
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11488 Lge1 277 343 Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:12853457}.
Sequence
MWSEGRYEYERIPRERAPPRSHPSDGYNRLVNIVPKKPPLLDRPGEGSYNRYYSHVDYRD
YDEGRSFSHDRRSGPPHRGDESGYRWTRDDHSASRQPEYRDMRDGFRRKSFYSSHYARER
SPYKRDNTFFRESPVGRKDSPHSRSGSSVSSRSYSPERSKSYSFHQSQHRKSVRPGASYK
RQNEGNPERDKERPVQSLKTSRDTSPSSGSAVSSSKVLDKPSRLTEKELAEAASKWAAEK
LEKSDESNLPEISEYEAGSTAPLFTDQPEEPESNTTHGIELFEDSQLTTRSKAIASKTKE
IEQVYRQDCETFGMVVKMLIEKDPSLEKSIQFALRQNLHEIES
AGQTWQQVPPVRNTEMD
HDGTPENEGEETAQSAPQPPQAPQPLQPRKKRVRRTTQLRRTTGAPDITWGMLKKTTQEA
ERILLRTQTPFTPENLFLAMLSVVHCNSRKDVKPENKQ
Sequence length 458
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Colorectal Cancer Colorectal cancer N/A N/A GWAS
Coronary artery disease Coronary artery disease N/A N/A GWAS
Glioblastoma Glioblastoma N/A N/A GWAS
Gout Gout N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 26070530
Carcinoma Ovarian Epithelial Associate 11592776
Lamellar ichthyosis type 3 Associate 16117785
Lymphatic Metastasis Associate 11592776
Stomach Neoplasms Associate 34135559